KEGG   Pseudomonas mendocina NK-01: MDS_1012Help
Entry
MDS_1012          CDS       T01473                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00473  D-Alanine metabolism
pmk00550  Peptidoglycan biosynthesis
pmk01100  Metabolic pathways
pmk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MDS_1012
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MDS_1012
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MDS_1012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmk01011]
    MDS_1012
Enzymes [BR:pmk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MDS_1012
Peptidoglycan biosynthesis and degradation proteins [BR:pmk01011]
 Precursor biosynthesis
  Amino acid ligase
   MDS_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_5 RimK ATPgrasp_YheCD ATPgrasp_Ter TTL
Motif
Other DBs
NCBI-ProteinID: AEB57043
LinkDB All DBs
Position
1112242..1113183
Genome map
AA seq 313 aa AA seqDB search
MSLHSTLDPKAFGRVAVLFGGKSAEREVSLKSGNAVLSALQAAGVDAFGIDVGDDFLARL
NSEKIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWHSLGLP
TPRHAVLTSQADCKAAATELGFPLIVKPAHEGSSIGMAKVESVEALVAAWQDAARYDSQV
LVEQWIAGPEYTIAVLRGEVLPPIGLGTPHTFYDYDAKYLADDTQYRIPCGLSAEKEAEL
KSLTARACEAVGTQGWARADVMQDASGQFWLLEVNTVPGMTDHSLVPMAARAAGLDFQQL
VLAILADSVEARG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcacagtaccctcgatcccaaggctttcggtcgcgtcgccgtgctgttcggt
ggcaagagcgccgagcgcgaggtgtcgctgaagtccggcaatgcagtgctcagcgccctg
caggcggctggcgtggacgccttcggcatcgacgtgggtgatgatttcctggctcgtttg
aacagcgagaagatcgaccgcgccttcatcgtgctgcacggccgcggtggcgaggacggc
tcgatgcagggcctgctcgagtgcgccggcattccttataccggtagcggcatcctcgcc
tcggcgctggccatggacaagctgcggaccaaacaggtctggcacagcctcggtctgccg
acgccgcgccatgccgtgctgacttcgcaggccgattgcaaggctgccgccactgaactg
ggcttcccgctgatcgtcaaaccggcccacgaaggctcgagcatcggcatggccaaggtc
gagagcgtcgaggcgctggtcgctgcctggcaggacgcggcccgctacgacagccaggtg
ctggtcgagcagtggatcgccgggcccgagtacaccatcgccgtcttgcgtggtgaagtg
ctgccgcccatcggcctcggtacaccgcacaccttctacgactacgacgccaagtacctg
gccgatgacacccagtaccggattccctgcggcctgtccgcggagaaggaagccgagttg
aagtcgctcaccgcacgtgcctgcgaggccgtaggcactcagggctgggcgcgcgccgat
gtgatgcaggatgccagtggccagttctggctgctggaagtgaacaccgtaccgggcatg
accgatcacagcctggtgcctatggccgcgcgcgccgccggcctggatttccagcaactg
gtgctggcgatcctggccgacagcgtcgaggcgaggggttaa

DBGET integrated database retrieval system