KEGG   Pseudomonas mendocina NK-01: MDS_1353Help
Entry
MDS_1353          CDS       T01473                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MDS_1353
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MDS_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored Glutaredoxin AlaDh_PNT_C DAO Thi4 NAD_binding_8 FAD_binding_3 K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AEB57384
LinkDB All DBs
Position
1474257..1475813
Genome map
AA seq 518 aa AA seqDB search
MLDANLKAQLKAYLEKVTQPFEIVASLDDGEKSQELLGLLQDIVGLTDKITLKTDGNDAR
RPSFALNRPGGDTGVAFAGIPMGHEFTSLVLALLQVGGHPSKLDADTIAQIKSIEGKFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRNVSIDGALFQEEVERRQVMAVPSIYLNGEVF
ASGRMDVKEILAKIDTGAANRDAEKMSAKEAFDVLVVGGGPAGAAAAIYAARKGIRTAIA
AERFGGQVLDTMAIENFISVKETEGPKLVRALEEHVKEYDVDVMNLQRASALVPASSEGG
LHEVKFENGASLKAKTVILSTGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQKKLYSLPNVTVIKSAQTTEVKGDG
QKVTGLVYKDRTTEELHTVELEGIFVQIGLLPNSDWLKGTVELSRFGEIVIDAKGATNIP
GVFAAGDVTTVPYKQIVIAMGEGSKASLSAFDHLIRHS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaggcctacctggaaaaggtcacccagccg
ttcgagatcgtcgcgtccctcgatgacggcgaaaaatcccaggaactgctcgggctgctg
caagacatcgtcggcctgaccgacaagatcactctgaagaccgacggcaacgatgcccgc
cgtccgtccttcgccctgaatcgtccgggcggagacaccggcgttgccttcgccggtatt
cccatgggccacgaattcacctcgctggtgctggcactgctgcaggtgggcggccatccg
tccaagctggatgcagacaccatcgcgcagatcaagagcatcgaaggcaagttcgagttc
gagacctacttctcgctgtcctgccagaactgcccggacgtggttcaggcgctgaacctg
atggccgtgctcaaccccaatatccgcaacgtctccatcgacggtgcgctgttccaggaa
gaagtcgagcgtcgccaggtcatggccgtgccgagcatctacctgaacggtgaggtcttc
gcttccggtcgcatggacgtgaaggaaatcctcgccaagatcgacaccggcgccgccaat
cgcgatgccgagaaaatgagtgccaaggaagccttcgacgtgctggtggtcggcggtggc
ccggccggcgccgcagcggccatctacgctgcgcgcaagggcatccgcaccgctatcgct
gccgagcgcttcggcggtcaggtgctggacaccatggccatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggtgcgtgcgctggaagaacacgtcaaggaatacgac
gtcgacgtgatgaatctgcaacgtgcgtcggctctggtgccggccagcagcgaaggcggc
ctgcacgaggtgaagttcgagaacggcgcttcgctcaaggccaagaccgtgatcctctct
accggtgcgcgctggcgtgaaatgggcgtgcccggcgagcaggagtacaaggccaagggc
gtgtgtttctgcccgcactgtgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggtaactccggcgtcgaagcagccatcgacctggccggcatcgtcgcccacgtg
accctgctggaattcgccgacaccctgcgtgccgacgccgtactgcagaagaaactctac
agcttgccgaacgttaccgtgatcaagagcgcacagaccaccgaggtcaagggcgacgga
cagaaggtcaccggtctggtgtacaaggaccgcaccaccgaggaactgcataccgtcgag
ctggaaggcatcttcgtgcagatcggtctgctgcccaacagcgactggctcaagggcacc
gtcgagctgagccgcttcggtgagatcgtcatcgatgccaagggcgctactaacatcccc
ggtgtgttcgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtcatcgccatg
ggcgagggctcgaaggcttcgctgtccgccttcgaccacctgatccgccatagctga

DBGET integrated database retrieval system