KEGG   Pseudomonas mendocina NK-01: MDS_1376Help
Entry
MDS_1376          CDS       T01473                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MDS_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEB57407
UniProt: F4DW89
LinkDB All DBs
Position
1497718..1498269
Genome map
AA seq 183 aa AA seqDB search
MKPLIPLAFALLGATSLQASETVTVTLEQATEKGTGASVGTVTISQSPYGLVFTPDLQGL
EPGVHGFHVHTEANCNAAQVDGKMTPAGAAGGHWDPQNAGRHGFPWEDDAHLGDLPALLV
TEDGNASQPVLAPRLKRLEDLHNRSLMIHAGGDNHADHPQPLGGGGARVACGVIKVPTST
TPI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctgattccactagcattcgcactacttggtgccaccagcctacaggccagc
gagaccgttacggtgacgctcgagcaggccaccgagaaaggtactggtgcatctgtcggc
accgtgaccattagtcagtcaccttacgggctggtgtttacccctgatctgcaggggctg
gagcctggcgtccacggtttccacgtgcacaccgaggccaactgcaatgccgcgcaggtg
gatggcaagatgacgcccgctggtgccgcaggtggccattgggacccgcagaacgccggc
cgccacggtttcccctgggaagacgatgcccatctcggcgacctgccggctttgctcgtc
accgaggatggcaacgccagccagccggtgctggcaccgcgactcaagcgtctggaggac
ctgcataaccgctcgctgatgattcatgccggtggcgacaatcacgccgatcatccgcaa
cctctgggcggcggcggtgcgcgcgtggcctgcggggtgatcaaggtgccgaccagcacc
acgccgatttga

DBGET integrated database retrieval system