KEGG   Pseudomonas mendocina NK-01: MDS_1633Help
Entry
MDS_1633          CDS       T01473                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00071  Fatty acid degradation
pmk00280  Valine, leucine and isoleucine degradation
pmk00281  Geraniol degradation
pmk00310  Lysine degradation
pmk00362  Benzoate degradation
pmk00380  Tryptophan metabolism
pmk00410  beta-Alanine metabolism
pmk00640  Propanoate metabolism
pmk00650  Butanoate metabolism
pmk00903  Limonene and pinene degradation
pmk00930  Caprolactam degradation
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
pmk01212  Fatty acid metabolism
Module
pmk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MDS_1633
   00650 Butanoate metabolism
    MDS_1633
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MDS_1633
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MDS_1633
   00310 Lysine degradation
    MDS_1633
   00380 Tryptophan metabolism
    MDS_1633
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MDS_1633
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MDS_1633
   00281 Geraniol degradation
    MDS_1633
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MDS_1633
   00930 Caprolactam degradation
    MDS_1633
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MDS_1633
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MDS_1633
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MDS_1633
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     MDS_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEB57664
LinkDB All DBs
Position
1780698..1782845
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRASVDAIKADGSIKGVIVTS
GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLAVPTVVAINGIALGGGFE
MCLAGDYRVMSETAKIGLPEVKLGIYPGFGGTVRLPRVIGTDNAVEWIASGKENRAEDAL
KVGAVDAVVAPAKLKDAALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMCFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSVAESLIGLFLNDQEL
KKKAKHHDEIARDVKLAAVLGAGIMGGGIAYQSASKGTPILMKDIREEGIQMGLNEASKL
LGKRVEKGRMTPAKMAEALNAIRPTMSYGDFGNVDIVVEAVVENPKVKQIVLAEVEAVVR
EDAILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFSKLLGFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVSDPAAYELLKSIVVEEREVTDEDIINFMMIPLCLETVRCLEDGIVDTAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAAKGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaacaaattcaaccgtcttaccctcaacgagctg
cgcgcttccgtcgacgcgatcaaggctgacggttcgatcaagggcgtgattgtcaccagt
ggcaaggacgtgttcatcgtcggtgccgatatcaccgagttcgtcgacaacttcaaactg
cccgacgaagagctggtggctggcaacctggaagccaacaagatcttcagtgatttcgaa
gacctcgccgtgccgaccgtcgtcgccatcaacggcatcgccctgggtggcggcttcgag
atgtgcctggccggtgactaccgcgtaatgagcgagaccgccaagatcggtctgccggaa
gtcaagctgggcatctacccgggctttggcggtactgtgcgtctgccgcgtgtgatcggt
accgacaacgctgtcgagtggatcgcctccggtaaggaaaaccgcgcggaagacgcgctg
aaagtcggcgccgtcgatgcggtggtcgctcccgccaagctcaaggatgctgctctggat
ctggtcaagcgtgccatctccggcgagctggactacaaggccaaacgtcagcccaagctg
gaaaaactcaagctcaacgccatcgaacagatgatgtgcttcgagaccgccaagggcttc
gtcgccggtcaagccggtccgaactacccggcgccggtcgaggcgatcaagaccattcag
aaagctgccaacttcggccgcgacaaggcgctggaagtcgaggctgccggcttcgtcaag
ctggccaagacttcggttgccgagagcctgatcggcctgttcctgaacgatcaggaactg
aagaagaaggccaagcaccacgacgaaatcgctcgtgacgtgaaactggctgccgtactc
ggcgccggcatcatgggcggtggtatcgcctaccagtcggcctccaagggcacgccgatc
ctgatgaaggatatccgtgaagagggtatccagatgggcttgaacgaggcctccaagctg
ctcggcaagcgcgtcgagaagggtcgcatgaccccggcgaagatggccgaagccctcaac
gccatccgtccgaccatgtcctatggtgatttcggcaacgtcgacatcgtcgtcgaagcc
gtggtcgagaaccccaaggtcaagcagatcgtgctggccgaggtggaagctgtggtgcgt
gaagatgccatcctggcctccaatacctcgaccatctccatttccctgctggcccaggcg
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtcatccgtggcgagaaatccagcgaagtggccgtggccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgccccggcttcctggtc
aaccgtgtgctgttcccgtacttcggcggcttctccaagctgctgggtttcggcgtcgac
ttcgtgcgcatcgacaaggtgatggagaagttcggctggcccatgggcccggcttatctc
tccgacgtggttggcatcgacaccggccaccatggccgtgacgtgatggccgagggcttc
ccggatcgtatggccgtagaaggcaagactgccgtcgacgtgatgtacgaggccaaccgc
ctgggccagaagaatggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtctccgacccggctgcttacgagctgctcaagtccatcgtggtcgaagagcgt
gaagtcaccgacgaggacatcatcaacttcatgatgattccgctgtgcctggaaactgtt
cgttgcctggaagacggcatcgtcgataccgcagccgaggccgacatgggcctgatctac
ggtatcggcttccctcccttccgtggcggtgcgctgcgctatatcgattccatcggtgta
gctgaattcgtcgccctggctgacaaatatgccgagctgggcgccctgtaccacccgacc
gcaaaacttcgtgaaatggccgccaagggccagaagttcttcggttaa

DBGET integrated database retrieval system