KEGG   Pseudomonas mendocina NK-01: MDS_1707Help
Entry
MDS_1707          CDS       T01473                                 

Definition
(GenBank) transketolase central region
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00030  Pentose phosphate pathway
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
pmk01230  Biosynthesis of amino acids
Module
pmk_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MDS_1707
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MDS_1707
Enzymes [BR:pmk01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MDS_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AEB57738
LinkDB All DBs
Position
1855459..1856457
Genome map
AA seq 332 aa AA seqDB search
MSSTAKKPRLTTSAMIASIASEGQRVQSAPFGKALVELAANRPEIVGLTADLAKYTDLHL
FAQAYPDRFFQMGMAEQLLMAAAGGMAKEGFVPFATTYAVFATRRAFDFVHQVIAEENLN
VKLCCALPGLTTGYGPSHQATEDIALMRGIPGMTIVDPCDALDTEQAVPQIAAHNGPVYM
RLLRGNVPLVLDEYGYSFELGKAKMLRDGRDVLVISSGILTMRALEVAKALEADRIDVGV
LHVPTIKPLDVATILREAGKAGRLVVVAENHTSVGGLGEAVATALLTAGVTPQFRQIALP
DAFLDAGALPTLHDRYGISTEAMSATIKGWLG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccgccaagaaaccacgcctgaccacctcggcgatgatcgcctcgattgcc
tccgaagggcagcgcgtacagtcggccccattcggcaaggccctggtcgaactggccgca
aaccgcccggagatcgtcggcctgaccgccgacctggccaagtacaccgatctgcacctg
ttcgcccaggcctacccggatcgcttcttccagatgggtatggccgagcaactgctgatg
gctgctgccggcggcatggccaaggaaggcttcgtgccgttcgccaccacctacgcggtg
ttcgctacgcggagagccttcgacttcgtgcaccaggtgatcgccgaggaaaacctcaac
gtcaagctgtgctgcgcgttgcctggtctcaccaccggctatggccccagccaccaggcc
accgaggacattgcgctgatgcgtggcatccccggcatgactatcgtcgacccctgtgat
gcgctcgatacggagcaggccgtgccgcagatcgctgcgcacaacggcccggtttatatg
cgcctactgcgcggcaacgtgccgctggtactcgacgagtacggctacagctttgaactg
ggcaaggccaagatgctgcgcgacggccgcgacgtgctggtgatctcgtccggcatcctg
accatgcgcgcgctggaagtggccaaggcgctggaggcggaccggatcgacgtcggcgtg
ttgcacgtgcccacaatcaagccgctcgacgtggcgaccatcctgcgtgaagccggaaag
gccgggcgccttgtggtcgtggcggagaaccacacctcggtcggggggcttggcgaagcc
gtggccaccgcgctgctgactgccggggtgactccgcaatttcgccagatcgcgctgccc
gatgccttcctggacgccggtgcgctgccaacgctgcatgaccgttacggtatttccacc
gaggcgatgtcggccaccatcaagggttggctcggctga

DBGET integrated database retrieval system