KEGG   Pseudomonas mendocina NK-01: MDS_2373Help
Entry
MDS_2373          CDS       T01473                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00020  Citrate cycle (TCA cycle)
pmk00480  Glutathione metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
pmk01210  2-Oxocarboxylic acid metabolism
pmk01230  Biosynthesis of amino acids
Module
pmk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MDS_2373
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MDS_2373
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MDS_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115
Motif
Other DBs
NCBI-ProteinID: AEB58404
UniProt: F4DT94
LinkDB All DBs
Position
complement(2595460..2597688)
Genome map
AA seq 742 aa AA seqDB search
MSTPSKIIYTFTDEAPALATYSLLPIVEAFAASADISVETRDISLAGRILASFADRLDAD
KRIDDDLAKLAELTLQPDANIIKLPNISASVPQLKAAIAELQAQGYNIPDFPEDPQSEED
KEVRARYAKVLGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASQSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLALQEGEVFDSMFMSCRKLRAFFEKTL
QDCKETGVMWSLHVKATMMKVSHPIVFGHAVSVYYKDVFDKYGDLFKELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYAHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVAADGTVLMQHEVEAGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELQKKVELYLKDHDLTGLDIRMMGYNEAIRVSMERMIRGQDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTNNAKAKVLGKTLDQATGKLLDNNKSPARKVGEIDNRGSH
FYLALYWAQALAEQNDDAELKAHFAPLAKQLTEQEATIVAELAAVQGKPAEIGGYYRSNP
ELTSKVMRPSTTFNAALAALNA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccttcgaagatcatctacaccttcaccgacgaagccccggcacttgccacc
tattcgcttctgcccatcgtggaagcctttgccgcctcggctgacatctccgttgaaacc
cgcgacatctctcttgctgggcgaatcctggcgagctttgccgaccgtctggacgctgac
aagcgcatcgatgacgacctggccaagctggctgagctgaccctgcagcctgacgccaac
atcatcaaactgccgaacatcagtgcctccgtccctcagctcaaggccgccatcgccgag
ctgcaggcccagggctacaacatcccggacttcccggaagatccgcagagcgaagaagac
aaggaagttcgcgcgcgttacgccaaggttctcggcagcgctgtcaacccggttctgcgc
gaaggcaactccgaccgccgtgctccggccgcggtaaaagcctacgcccgcaagcacccg
cacagcatgggcaagtggagcatggcttcgcagtcccacgccgactacatgcgcggcggc
gacttcttctccagcgagcagtcgatcaccatggccaaggccggtgatgtgcgtatcgag
ttcgtcggcaaggacggcaaggtcgaagtcaagaaacaactcgccctgcaggaaggcgaa
gtgttcgacagcatgttcatgagctgccgcaagctgcgcgccttcttcgagaagaccctg
caagactgcaaggaaaccggcgtaatgtggtccctgcacgtcaaggcaaccatgatgaag
gtctcccacccgatcgtcttcggtcatgccgtcagcgtttactacaaggacgtgttcgac
aagtacggcgacctgttcaaggaactgggcgtcaacccgaacaacggcatcagcagcgtc
tacgacaagatcaagtcgctgccagcctcgcagcaggaagaaatcctgcatgacatccac
gaggtttatgctcatcgcccggaaatggcgatggtcgactcggtcaagggcatcactaac
ctgcacatcccgagcgacgtcattgtcgacgcctcgatgccggccatgatccgcaactcc
ggtcagatgtggggcaaagatggcaagcagaaagacaccaaggcggtcatgcctgagagc
acctacgctcgcatctatcaggaaatgatcaacttctgcaaaaccaacggtgcgttcgac
ccgaccaccatgggcagcgtgccgaacgttggcctgatggcgcagaaagccgaagaatac
ggctctcacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtcgtagctgcc
gatggcaccgtgctgatgcagcacgaagtcgaagctggcgatatttggcgcgcctgccag
accaaggacgccccgatccgcgactgggtcaagctggccgttacccgtgcccgtcaatcc
gataccccggccatcttctggctggacccggagcgcgcccatgatcgcgagctgcagaag
aaagtcgagctgtacctcaaggatcacgatctgaccggtctggacattcgcatgatgggc
tacaacgaggccatccgcgtgtccatggagcgcatgatccgtggccaggacaccatctcg
gtgaccggtaacgtgctgcgtgactacctgaccgacctgttcccgatcatggagctgggt
acttcggccaagatgctgtccatcgttccgctgatggccggcggcggcatgtatgaaacc
ggcgccggcggctcggctcccaagcacgtacaacagctggtcgaagagaactacctgcgc
tgggattccctgggcgagttcctggccttggccgtatcgctggaagaaaccggcatcaag
accaacaacgccaaggccaaggtactgggcaagaccctggaccaggctaccggcaagctg
ctggacaacaacaagtccccggcgcgcaaggtgggtgagatcgacaaccgtggcagccac
ttctatctggcgctgtactgggctcaagccctggccgagcagaacgacgatgccgagctg
aaggctcacttcgcgccgctggccaagcaattgaccgagcaggaagcgaccatcgttgcc
gaactggctgccgtgcaaggcaagccggctgagatcggtggctactaccgctccaacccc
gagctgaccagcaaggtgatgcgacccagcactaccttcaatgccgctctggctgcactg
aatgcctga

DBGET integrated database retrieval system