KEGG   Pseudomonas mendocina NK-01: MDS_2438Help
Entry
MDS_2438          CDS       T01473                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00500  Starch and sucrose metabolism
pmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MDS_2438
Enzymes [BR:pmk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MDS_2438
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MDS_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459
Motif
Other DBs
NCBI-ProteinID: AEB58469
LinkDB All DBs
Position
2659802..2663101
Genome map
AA seq 1099 aa AA seqDB search
MAKRSAGKTFLNDPQWYKDAVIYQVHVKSFFDANNDGIGDFQGLIDKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAKYNDVHPDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHP
WFQRARRAKKGSKARDYYVWSDSDEKYAGTRIIFIDSEKSNWTWDAVAGQYFWHRFYSHQ
PDLNFDNPKVLEAVLGVMRFWLDMGVDGLRLDAIPYLIERDGTSSENLPETHAVLKRIRA
ELDARYPDRLLLAEANQWPEDTRPYFGEDDECHMAFHFPLMPRMYMAIAQEDRFPITDIL
RQTPEIPPNCQWAIFLRNHDELTLEMVTDDERDYLWNYYAADSRARINLGIRRRLAPLVG
RDRRRIELLNSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSVDRNGGFSRAD
PASLVLPPIMDPLYGYQTINVEAQARDPHSLLNWTRRMLAIRNQHKAFGRGSLTMLTPSN
RRILAYLRMHRGEDGSEQQILCVANLSSAAQAVELELADYRDRVPVEMIGGASFPPIGQL
TYLLTLPPYGFYWFYLADASQMPSWHLKPVERMPELQTLVLGRTLSEVMDGRARQTLERE
SLPLYLPKRRWFAGEQRPAVSVLYVMPLGGDANAPLLAEVQVTGVGGVEHYRLPLAAVPE
RAEGNDLPQQLALARLRRGRHVELLTDAFSLPQFSQQVLRLLREQAVLRSAGGELQFRAE
AALLALEGIDENDFKLLSAEQSNSSALIGGQVLLKLLRRGFAGIHPEVEMGRFLTDHGYA
NVAPFLGEVVRVDEQGQPHTLMVMQRYLDNQGDAWQWTLNTLDRAIRDQLAGGTADPDVD
ALGELQQFAGVLGKRVGEMHAVLARPVENPDFGYQLSGERDSAHWAKSITAQLQEALQAL
ARQRDALSPATVEQADWLLAREKSLLEAVTRLATQAAGGLRIRVHGDLHLGQVLVVQGDA
YIIDFEGEPNRSLEERRQRHSPFKDVAGMLRSFDYAAAVAHRNAGGVEGAADAQQVVRDV
VSRYREQACSAFLDAYRLAANGLPHEWHEREGEGAALDLFCLEKAVYEIVYESGHRPDWI
DVPLQGLVDLANQLLGVRP
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgcagcgccggcaagacctttctcaacgatccgcagtggtacaaggatgcg
gttatctatcaggtccacgtgaagtccttcttcgatgccaacaacgatggcatcggcgac
ttccagggcctgatcgacaagctcgactatatcgccgaactgggggtgaacaccctctgg
ctgctgccgttctacccctcgccacggcgcgacgacggctatgacatcgccaagtacaac
gatgtccatccggactatggcagcctggccgacgcccgccgtttcatcgccgaggcgcac
cggcgcggcctgcgcgtgatcaccgagttggtgatcaaccacacctccgatcagcacccc
tggttccagcgcgcacgccgggcgaagaagggctccaaggcgcgcgactattacgtctgg
tccgacagcgacgagaaatacgccggcacgcggatcatcttcatcgacagcgagaagtcc
aactggacctgggacgcggtggccggccagtacttctggcaccgcttctactcgcaccag
ccggacctcaatttcgacaatccaaaggtgctcgaagccgtgctcggggtcatgcgcttc
tggctcgacatgggcgtcgatggcctacgcctggacgccattccgtacctgatcgagcgt
gacggcaccagcagcgagaacctgccggagacccacgccgtgctcaagcgcatccgcgcc
gaactggatgcgcgctacccggatcgcctgctgctggccgaggccaaccagtggccggag
gacacccgaccttacttcggtgaagacgacgaatgtcatatggccttccatttcccgctg
atgccgcgcatgtacatggccatcgcccaggaagaccgctttccgatcaccgacatcctg
cgccagacgccggagattccgcccaattgccagtgggcgatcttcctgcgcaaccacgat
gagctgaccctggaaatggtcaccgacgacgagcgcgactacctgtggaactactacgcc
gccgacagtcgcgcacggatcaacctcggcattcgccggcgcctggcgcccctggtaggg
cgtgaccggcggcgcatcgagctgctcaacagtctgctgctgtcgatgcccggcacgccg
acgctgtactacggcgacgagctcggcatgggcgacaacatctacctcggcgatcgcgat
ggcgtgcgtacgccgatgcagtggtcagtggaccgcaacggcggcttctcccgcgccgat
ccggcgagcctggtactgccgccgatcatggacccgctgtacggctaccagaccatcaac
gtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggacgcggcgcatgctcgcc
atccgcaaccagcacaaggccttcggccgtggctcgctaacgatgctgacgccgagcaat
cggcgcatcctggcgtacctgcgcatgcatcgaggcgaggacggcagcgagcagcagata
ctctgcgtggccaacctgtccagtgcggcccaggccgtcgagctggaactggccgactac
cgcgaccgggtgccggtggaaatgatcggcggcgcctcgttcccacccattggccagctc
acctacctgctgacgttgccgccgtacggtttctattggttctacctggccgacgcctcg
cagatgcccagctggcacctgaaaccggtggagcgtatgccggagctacagaccctggtg
ctgggtcgcaccctgagcgaagtgatggacgggcgcgcgcggcagacgctggagcgcgag
tcgctgccgctgtatctgcccaagcgccgctggttcgcgggtgaacagcgcccggccgtc
agcgttttgtacgtgatgccgcttggcggcgatgccaacgcgccgctgctggccgaggtt
caggtgacgggggtgggcggcgtcgagcattaccgcctgccgctggcggccgtgccggaa
cgcgccgagggtaacgatctaccacagcaactggcgctggcccggctgcgccggggtcgc
catgtggagctgctgaccgatgccttcagcctgccgcagttcagccagcaggttctgcgc
ctgctgcgtgagcaggcagtgctgcgcagcgctggcggcgaattgcagttccgcgccgag
gcggcgctgctggcgctcgaaggtatcgacgagaacgacttcaagctgctctccgccgag
caatccaacagctcggcgctgatcggagggcaggtgctgctcaagctactgcgtcgcggc
ttcgccggtatccacccggaagtggagatggggcgttttctgaccgatcacggctacgcc
aacgtcgcgccatttcttggcgaagtggtgcgggtcgacgagcaaggccagccccataca
ctgatggtgatgcaacgttatctggacaatcagggcgacgcctggcaatggacgctcaac
acccttgaccgcgccatccgcgatcagttggccggcggtaccgccgatccggatgtcgat
gcgttgggcgaactgcaacagttcgccggcgtgctcggcaaacgcgtcggcgagatgcac
gcggtactggcgcggccggttgagaatccggacttcggttatcagctcagcggcgagcgc
gacagcgcccactgggccaaatccatcacggcgcagctgcaggaagccttgcaagctctg
gctcgtcagcgggacgccctgagcccggcgacagtcgaacaggccgactggctgctggcc
agggagaaatccttgctggaggccgtcacccgcctggcaacgcaggcggcaggtggcctg
cgcatacgggtgcatggcgaccttcacctgggccaggtcctggtggtgcagggcgatgcc
tacatcatcgacttcgagggcgagcccaaccgctcgctggaggagcgccgccagcgccac
agtccgttcaaggacgttgccggcatgctgcgctccttcgactacgcggccgcggtagcc
caccgcaacgccggcggcgtggaaggcgcggcggacgcccagcaggtagttcgcgacgtg
gtgtcacgctaccgcgagcaagcgtgcagtgcctttctcgatgcctatcgtctggccgcc
aacggcctgccccacgaatggcacgaacgcgaaggcgagggcgccgccctcgacctgttc
tgcctggaaaaggctgtctatgaaatcgtctacgaaagcggccaccgccccgactggatc
gatgtcccgttgcaggggctggtggatctcgctaaccaattgctaggagtgcgaccttga

DBGET integrated database retrieval system