KEGG   Pseudomonas mendocina NK-01: MDS_3687Help
Entry
MDS_3687          CDS       T01473                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00620  Pyruvate metabolism
pmk00680  Methane metabolism
pmk01100  Metabolic pathways
pmk01120  Microbial metabolism in diverse environments
pmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MDS_3687
  09102 Energy metabolism
   00680 Methane metabolism
    MDS_3687
Enzymes [BR:pmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MDS_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase HAMP PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEB59718
LinkDB All DBs
Position
complement(4058517..4061153)
Genome map
AA seq 878 aa AA seqDB search
MAEIDARLREEVHLLGELLGHTISTQLGDEFLDKIERIRKAAKAGRSGSDAGAEQLTSTL
GDLGDDELLPVARAFNQFLNLANIAEQQHRVRRRRAGEPEPFELRVLDELLERLLAEGQG
GDELARQLGRLDIELVLTAHPTEVARRTLIQKYDAIAAQLTALDHSDLSRGERERIVERL
QRLIAEAWHTEEIRRSRPSPVDEAKWGFAVIEHSLWQAVPQFLRRADQSLQAATGLRLPL
EAAPIRFASWMGGDRDGNPNVTARVTREVLLLARWMAADLYLRDVDHLAAELSMQQASDE
LRAQVGDSAEPYRALLKQLRERLRETRSWAQQALTADIAAGPSVLQDNRDLLAPLQLCYQ
SLHQCGMGVIADGPLLDCLRRAATFGLFLVRLDVRQDSARHAAALSEITDYLGLGRYGEW
DEEARLSFLQRELDSRRPLLPSDYRPSADTAEVLATCREVAAAPAASLGSYVISMAGAAS
DVLAVQLLLKEAGLRRPMRVVPLFETLADLDHAGPVMDRLLGLPGYRARLHGPQEVMIGY
SDSAKDAGTTAAAWAQYRAQEELVRLCREHQVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPAPEPSWRAMMDRLA
DVGVKAYRGVVREHPQFVEYFRQATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT
QTRLMLPAWLGWEQALGQALAGGDAELLKDMRERWPFFRTRIDMLEMVLTKADASIAALY
DERLVESTLQPLGAQLRDLLSQACAAVLELTGQSCLLAHNPETLESISVRNTYLDPLHLL
QAELLARCRQREQAPESPLEQALLVSVAGIAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatagatgcgcgtctgcgtgaagaggtgcacctgctgggtgaactgctaggg
cacaccatcagcacccagctgggcgatgagtttctcgacaagatcgagcgcatacgcaag
gcggccaaggccggtcgcagtggttctgatgccggtgccgagcagttgaccagcaccctg
ggtgacctcggcgacgacgagctgttacccgtggcccgtgcgttcaaccagtttctcaat
ttggccaatatcgccgagcagcaacatcgcgtgcgtcgccgccgtgcgggcgagcccgaa
ccgttcgagctgcgcgtgctggacgagttgctcgaacgcctgctcgccgagggacaaggt
ggcgatgaactggcgcgtcagctggggcgcctggacatcgaactggtgctgactgcgcac
cccaccgaagtagcgcggcgtaccctgatccagaaatacgatgccatcgccgcgcaactg
acggcgcttgatcacagcgacctgtcacggggtgaacgtgagcgcatcgtcgaacgcttg
caacggttgatcgccgaagcctggcacacggaggaaatccgccgcagccgacccagtccg
gtggatgaggccaagtggggctttgccgtcatcgaacattcgctgtggcaggccgtgccg
cagttcctacgtcgtgccgatcagagtctgcaggccgccaccggcttgcgcttgccgctg
gaggccgcgccgattcgtttcgcctcgtggatgggcggcgaccgtgatggcaaccccaat
gtcaccgctcgggtgacgcgcgaggtgctgctgctggcgcgctggatggctgccgatctg
tacttgcgcgatgtcgatcacctggccgccgagttgtccatgcagcaggccagcgatgag
ctgcgcgcgcaggtgggcgacagcgccgagccctaccgcgcgctgctcaagcaactgcgc
gagcgtttgcgagagacacgcagctgggcgcagcaggcgctaacggccgatatcgcagcg
gggccttcggtgttgcaggacaaccgcgatctgctggcgccgctgcaactgtgctatcag
tcgctgcaccaatgcggcatgggtgtcattgccgacggtccgctgctcgattgcctgcgc
cgtgccgcgaccttcggtctgttcctggtgcgcctcgacgtgcggcaggactctgcccgg
cacgctgcggcgctgtctgaaatcaccgattacctcggtcttggtcgctacggcgaatgg
gatgaggaggcgcgcctgagcttccttcagcgtgaactggatagccgccggccgttgcta
cccagcgactatcgtccctcggccgatacggccgaagtgctcgccacctgccgtgaggtg
gccgctgctcctgctgcctcgctgggctcttacgtgatctccatggccggtgccgcttcc
gacgtgctggcggtgcaactgctgctgaaggaggctgggttgcgccggccgatgcgtgtg
gtgccactgttcgaaaccctggccgacctcgatcacgccgggccggttatggatcgtcta
ttggggttgcccggctatcgtgcacgcctgcatggcccgcaggaagtgatgatcggctat
tccgactcagccaaggacgccggtaccaccgccgctgcctgggcgcagtaccgcgcccag
gaggaactggtgcgcctgtgtcgcgagcatcaggtcgagttgctcctgttccacggtcgt
ggtggcaccgtggggcgtggtggtggcccggctcacgctgccatcctgtcgcaaccgcct
ggctcggtcgcgggacgtttccgtaccaccgaacagggcgagatgatccgtttcaagttc
ggcctgccggatatcgccgagcagaacctcaatctctatctcgcagccgtgctggaagcc
acgctgttgccgccgccggccccggagcctagctggcgagcgatgatggatcgcctcgct
gatgtgggcgtgaaggcctatcgcggcgtggtgcgcgagcatccgcagttcgtcgagtac
ttccgccaggctacgccggagcaggagttgggccgtctgccactgggcagtcgtccggcc
aagcggcgtgaagggggtgtggaaagcctgcgcgcgatcccctggatcttcgcctggacc
cagacccgactgatgctgccggcctggctcggctgggagcaggcgttggggcaagcgttg
gcggggggcgacgccgagttgctgaaggatatgcgtgagcgctggcctttcttccgtacg
cgcatcgatatgctggagatggtgctgaccaaggccgacgccagtattgcggctctgtat
gacgagcgtctggtcgaatcgacgctgcagccgctgggtgcgcagttacgcgacctattg
tcgcaggcctgtgctgcggtactggaactgaccggccagtcgtgcctgcttgcgcacaat
ccggaaaccctggaatcgatcagcgtacgcaacacctatctcgacccgctgcacctgctg
caggccgagctgctggcgcgctgccggcaacgtgaacaggcgccggagagccctctggag
caggcgctgctggtcagcgtggcgggtatcgccgcgggtttgcgcaacaccggttga

DBGET integrated database retrieval system