KEGG   Pseudomonas mendocina NK-01: MDS_4261Help
Entry
MDS_4261          CDS       T01473                                 

Definition
(GenBank) glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MDS_4261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmk02000]
    MDS_4261
Enzymes [BR:pmk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MDS_4261
Transporters [BR:pmk02000]
 Other Transporters
  Pores ion channels [TC:1]
   MDS_4261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_C_2 GST_N_3 GST_C_3 GST_N_2 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AEB60292
LinkDB All DBs
Position
4671252..4671857
Genome map
AA seq 201 aa AA seqDB search
MKLYYKAGACSLSPHIALREAGLPFELEAVDLKTKLTASGKDFTRINGKGYIPALQLDND
KVLTEGAAIVQYIADLKPESGLAPANGSEARYELQSWLSFISSELHKPFGSMFNPAQSAD
WKAAAQALLSKRLDWLVTELGEREFLLGDRFTVADGYLFTVLGWAGMVGFSLDPWPSLQA
YHARIGARPKVIEALKVEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtactacaaagctggcgcctgctcgctctcgccgcacatcgcgctacgcgag
gccggcctgccgttcgaactggaagcggtcgacctgaagaccaaactcaccgcctcgggc
aaagacttcacccggatcaacggcaagggctacatccccgccctgcagttggacaacgac
aaggtgctaaccgaaggcgcggccatcgtgcagtacatcgccgacctcaagcccgaaagc
ggcttggccccggccaacggcagcgaagcacgctacgaactgcagagctggctcagcttc
atctccagcgaactgcacaagcccttcggcagcatgttcaatccggcgcagagcgcagac
tggaaagccgccgcccaggcgctgctgagcaagcgcctcgactggctcgtcaccgaactc
ggcgaacgcgagttcctgctcggtgaccgcttcaccgtggccgacggctacctgttcacc
gttctgggttgggccggcatggtcggtttctctcttgatccctggccgagcctgcaggcc
taccacgcccgaatcggcgcgcgtccgaaggtgatcgaagcactcaaggtcgaaggcctg
atctga

DBGET integrated database retrieval system