KEGG   Candidatus Phytoplasma mali: ATP_00459Help
Entry
ATP_00459         CDS       T00729                                 

Definition
(GenBank) predicted outer surface lipoprotein
Organism
pml  Candidatus Phytoplasma mali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: JIP_LZII CCCAP TPR_MLP1_2 DUF2046
Motif
Other DBs
NCBI-ProteinID: CAP18646
UniProt: B3R0R2
LinkDB All DBs
Position
548290..550488
Genome map
AA seq 732 aa AA seqDB search
MLNNNYFIKKSIFMFFIFLFFLGLIFFIKSKLFLSWDYFKESNKSLIDSKNFVLIKSKIK
ILEQDKDSLQAKIDSLSKEKEQEIATLEQDKASLQAKIDSLTNEKDKQIQNLQKEKTNLE
ATKITLEQDKASLQAKIDSLTNEKDKQIQNLQKEKTNLEATKITLEQDKASLQAKIDSLT
NEKDKQIQNLQKEKTNLEATKITLEQDKASLQAKIDSLTNEKDKQIQNLQKEKTNLEATK
ITLEQDKASLQAKIDSLTNEKDKQIQNLQKEKTNLEATKITLEQDKASLQAKIDSLTNEK
DKQIQNLQKEKTNLEATKITLEQDKASLQAKIDSLTNEKKREIKILEATKITLEQDKDSL
QAKIDSLTNEKDKQIQNLQKEKTNLEATKITLEQDKDSLQAKIDSLTNEKEQEKAALQKQ
IINLNNEKKQLEISKTINIPIVAEEPYLTYEDQNGDIIREYKFFENMIPKEKDNIGRINF
FSKKDFLDNMDKLKLDTYPIIWNEGIEKLGVLETNEKLKNKGIIKQPNIYKSDYRFIYTS
IPNGSDKELLTKFSNVTGIKRGRINDNISFSEKSSSNIDLMSNSSIRRLIFLKDEVNCIR
LMTKNLKLSFDWVRLITDKFQKYLPVTKKIIDLLLSNQLVEAKELSERNSEEPKFQFQIE
NNFQIPSNLYIRKIYNINDFTDFLKKLNLQKSDYLYDIREFVIYNIEKKLYDPYNKYHIQ
IPASNDNRQFLI
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaataataattattttattaaaaaatcgatttttatgttttttatatttttattt
tttttgggattaatattttttattaagtcaaaattatttctctcttgggactattttaag
gaatcaaataaaagtttaattgattccaaaaattttgttttaattaaatctaaaataaaa
attttagaacaagacaaagattctttacaagctaaaattgatagtttaagtaaagaaaaa
gaacaagaaatagctactttagaacaagacaaagcttctttacaagctaaaattgatagt
ttaactaatgaaaaagacaaacaaatacaaaatttacaaaaagaaaaaactaatttagaa
gcaacaaaaattactttagaacaagacaaagcttctttacaagctaaaattgatagttta
actaatgaaaaagacaaacaaatacaaaatttacaaaaagaaaaaactaatttagaagca
acaaaaattactttagaacaagacaaagcttctttacaagctaaaattgatagtttaact
aatgaaaaagacaaacaaatacaaaatttacaaaaagaaaaaactaatttagaagcaaca
aaaattactttagaacaagacaaagcttctttacaagctaaaattgatagtttaactaat
gaaaaagacaaacaaatacaaaatttacaaaaagaaaaaactaatttagaagcaacaaaa
attactttagaacaagacaaagcttctttacaagctaaaattgatagtttaactaatgaa
aaagacaaacaaatacaaaatttacaaaaagaaaaaactaatttagaagcaacaaaaatt
actttagaacaagacaaagcttctttacaagctaaaattgatagtttaactaatgaaaaa
gacaaacaaatacaaaatttacaaaaagaaaaaactaatttagaagcaacaaaaattact
ttagaacaagacaaagcttctttacaagctaaaattgatagtttaactaatgaaaaaaaa
agagaaataaaaattttagaagcaacaaaaattactttagaacaagacaaagattcttta
caagctaaaattgatagtttaactaatgaaaaagacaaacaaatacaaaatttacaaaaa
gaaaaaactaatttagaagcaacaaaaattactttagaacaagacaaagattctttacaa
gctaaaattgatagtttaactaatgaaaaagaacaagaaaaagctgctttacagaaacaa
attattaatttaaataatgaaaaaaaacaattagaaatatcaaaaacaataaatattcct
attgttgcagaagaaccttatttaacatatgaagatcaaaatggcgatataattagagaa
tacaaattttttgaaaatatgataccaaaggaaaaagataatattggtagaattaatttt
ttttctaaaaaagattttttagacaacatggataaacttaaattagatacttatccgatt
atttggaatgaagggattgaaaaattaggcgttttagaaacaaatgaaaaactaaaaaat
aaaggaataataaagcagcccaatatttataaatccgactatcgatttatttatactagt
attccgaatggtagtgacaaggagttattaactaaattttcgaatgtaactggaattaaa
cgaggtcgtattaatgacaacatatctttttcagaaaaatcaagcagtaatattgattta
atgtctaattctagtattagaagacttatttttttaaaagatgaagttaattgtatacgt
ttaatgactaaaaatttaaaattgtcttttgattgggtaagacttataactgataagttt
caaaaatatttacccgttacaaaaaaaattatagatttattattatcaaatcaattggta
gaagcaaaagaattgtctgaacgaaattctgaagaaccaaaatttcaatttcaaattgaa
aacaattttcaaattccgtcaaatttatatataagaaaaatttataatattaatgatttt
accgattttctaaaaaaattaaatttacaaaaaagtgattatttatatgatatccgtgaa
tttgttatttacaacattgaaaaaaagctttatgatccatataataaatatcatattcaa
attccggcttcaaatgataataggcaatttttaatttaa

DBGET integrated database retrieval system