KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0282Help
Entry
PMM0282           CDS       T00142                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00061  Fatty acid biosynthesis
pmm00780  Biotin metabolism
pmm01100  Metabolic pathways
pmm01130  Biosynthesis of antibiotics
pmm01212  Fatty acid metabolism
Module
pmm_M00083  Fatty acid biosynthesis, elongation
pmm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PMM0282 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PMM0282 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PMM0282 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmm01004]
    PMM0282 (fabI)
Enzymes [BR:pmm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PMM0282 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PMM0282 (fabI)
Lipid biosynthesis proteins [BR:pmm01004]
 Fatty acid synthase
  Component type
   PMM0282 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: CAE18741
CYORF: PMM0282
UniProt: Q7V313
LinkDB All DBs
Position
complement(271785..272567)
Genome map
AA seq 260 aa AA seqDB search
MLLNLSGKKILVTGIANNRSIAWGIAQQLSKAGAELGITYLPDDKGRFESKVRELTQPLN
PSLFLPLDVQNPAQIEEIFKNIKDNWGQIDGLVHCLAFAGRDELIGDYSATTSEGFDRAL
NISAYSLAPLCKAAKPLFSDGAGVVSLTYLGSERAIPNYNVMGVAKAALEASVRYLSAEL
GPEKQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRRTVTQTEVGNTAAFLLSDL
SSGISGQTIYVDAGYCINGM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaaatctatctggcaaaaaaattctggttacgggaattgccaataaccgttca
atagcatggggtattgctcaacaactttcaaaagctggcgcagaacttggaatcacatat
ttgcctgatgataagggaagattcgaatctaaagttagagaactaactcaaccgttaaac
ccatccttatttttgcctcttgatgttcaaaatccagctcaaattgaagaaatctttaaa
aatataaaagacaattggggtcaaattgacggattagttcactgcctagcatttgcagga
cgcgatgaattgattggagattatagtgccacgacttcagagggttttgatagggctctt
aatataagtgcgtattcgttagcacctttatgtaaagcagcaaaaccactttttagtgat
ggtgctggcgttgtctcattaacttatttaggttcagagagggcgatccctaactacaac
gtgatgggagttgcaaaagcagctttagaagcttcagtaagatatctttctgcagaactt
gggcccgaaaaacaagtcagagttaatgcaataagtgctggacctataagaacacttgct
agttctgctataggtggcattttagatatgattcacaatgttgaagaaaaggctccttta
cgcagaacagtcactcaaacggaagtaggtaatactgctgcttttttattaagtgatctc
tctagcggcatttcaggccaaacaatttatgttgatgcgggttactgcattaatggaatg
taa

DBGET integrated database retrieval system