KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0405
Entry
PMM0405           CDS       T00142                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of pyruvate de
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00010  Glycolysis / Gluconeogenesis
pmm00020  Citrate cycle (TCA cycle)
pmm00620  Pyruvate metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
pmm01120  Microbial metabolism in diverse environments
pmm01200  Carbon metabolism
Module
pmm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMM0405 (pdhC)
   00020 Citrate cycle (TCA cycle)
    PMM0405 (pdhC)
   00620 Pyruvate metabolism
    PMM0405 (pdhC)
Enzymes [BR:pmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMM0405 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Other DBs
NCBI-ProteinID: CAE18864
CYORF: PMM0405
UniProt: Q7V2R4
LinkDB
Position
383670..385037
AA seq 455 aa
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENQDEIASIQEQNKGKQTEVSSDGQLELPNNKPEIKEEKQKEV
PQNNEQEVEIKREKVLITSNEIQFNASTSNNSSRVIASPRAKKLASTMGVELAKVHGSGP
HGRIQADDVLKANGQPVSIPWIGEGSSPASISSPHVQAESKSETLGNSFGNPGETVQFNT
LQKAVNKNMESSLNVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRAKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANNDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLSSLIENEPETLVA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctcacgaaatatttatgccagctcttagttctactatgactgaaggcaaaattgtt
gaatggttaaagaatcctggagataaagttgaaagaggagaatctgttttagttgttgaa
tcagataaagctgatatggatgttgaatcttttcaagatggatatcttgctgcagtacta
atgccagctggtagtactgctccagttggtgaaaccattggacttattgtagagaatcag
gatgagatagcttctatacaagaacaaaataaaggtaaacagactgaagtatcaagtgat
ggtcaactcgaattaccaaataataaacctgaaataaaagaagaaaagcaaaaagaggtg
cctcaaaataatgagcaggaagtcgagattaaaagggaaaaagtgctaattacctctaat
gagattcaatttaacgcctctactagtaataattcttcaagagtaatagcatctccaagg
gcaaaaaaacttgcttctacaatgggagtcgaattagcaaaagtgcatggatcaggacct
catggaaggattcaggctgatgatgtattgaaggcaaatggccaacctgtgtctattcca
tggataggagagggaagttctcccgccagtatttctagtcctcatgttcaagccgaaagc
aagtcagagacattagggaatagttttggaaaccccggggaaactgtacaatttaatact
cttcaaaaagctgtaaataagaatatggaatcaagtttaaatgttccatgttttagagtt
gggtattcaattaatactgataaattggataatttttacaagaaagtaaagcaaaatgga
gttactatgactgcgttgttagtcaaggcagttgcaaagacacttaaaaaacatccccaa
gttaattcaagcttttcagaaaacggaatttcttatccagaaaatataaatattgctgtg
gctgttgctatggaagatggagggttgataactccagtattaaaagaaccttgtaacact
gatttatttgaattatctagagagtggaaagatcttgtgaaaagatctagagcaaaacaa
ttagaaccagatgaatactcaacaggaacatttactttgtcaaatttaggaatgtttggt
gttgacaggtttgatgcaatacttccaccaggtacaggtgcgattttagccatagcatca
tcgaagccaacagttgttgctaataatgatggctcaatatctgttaaaaaaataatgcaa
gtaaacttaaccgctgatcatagagtaatttatggtgctgatggtgcatcattcttaaaa
gacttgtcttctctcattgaaaacgagccagaaacacttgtagcctaa

DBGET integrated database retrieval system