KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0543Help
Entry
PMM0543           CDS       T00142                                 

Gene name
chlL,frxC
Definition
(GenBank) Protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00860  Porphyrin and chlorophyll metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMM0543 (chlL)
Enzymes [BR:pmm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     PMM0543 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 MeaB SRP54 MipZ NB-ARC AAA_25 RNA_helicase CBP_BcsQ PRK AAA_26 AAA_22
Motif
Other DBs
NCBI-ProteinID: CAE19002
CYORF: PMM0543
UniProt: Q7V2D7
LinkDB All DBs
Position
complement(512474..513361)
Genome map
AA seq 295 aa AA seqDB search
MTSTINKPLDGEGSVQVKQDPKVNIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMFEGFNGVMCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVSAIQAKAKNYKVRLGGVVANRSKDTDQIDKFNNRTGLKTMAHFKDVDAIRR
SRLKKCTIFEMEPTEDVVEVQNEYLSLAKNMLDNVEPLEGTPLKDREIFDLLGFD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtacaataaataagcctcttgatggagaaggtagtgttcaagtcaagcaagat
ccaaaagtaaatattgaagaaggagcattagtaattgctgtttatggtaaggggggtata
ggcaaatcaacaacgtcttctaatctttcagcagcattctcaaaattgggtaaaaaagtt
ttacaaatagggtgtgatccaaagcacgatagtacttttactcttactcacaagatggtt
cctactgttattgatattctggaggaagtggactttcatagtgaggaattaaggccaact
gactttatgtttgaggggtttaatggtgtaatgtgcgtcgagagtggaggtcctccagct
ggtacaggttgtggcggatatgtaacaggccaaacagtaaagctcttaaaagagcatcat
ttactagaagacaccgatgtagttattttcgatgtcttgggagacgtcgtttgtggaggt
tttgccgctcccttacaacacgctaattactgcctaattgtaacggctaatgactttgat
tcaatatttgcaatgaatagaattgtttctgcaattcaagcaaaagcaaaaaattataaa
gttcgattaggtggagtagtagcaaatagatccaaagataccgatcaaattgataagttc
aataatagaactggtttaaaaaccatggctcactttaaagatgtagatgccattagaaga
tcaaggcttaaaaagtgtacgatttttgaaatggaaccaactgaagatgtggttgaggtg
caaaatgaatatttatctctcgctaaaaatatgttagacaatgtggaaccacttgagggt
actccactaaaagatagagaaatttttgatttattaggatttgattaa

DBGET integrated database retrieval system