KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0550Help
Entry
PMM0550           CDS       T00142                                 

Gene name
rbcL, cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase, large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00630  Glyoxylate and dicarboxylate metabolism
pmm00710  Carbon fixation in photosynthetic organisms
pmm01100  Metabolic pathways
pmm01120  Microbial metabolism in diverse environments
pmm01200  Carbon metabolism
Module
pmm_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmm_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmm_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PMM0550 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMM0550 (rbcL)
Enzymes [BR:pmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PMM0550 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAE19009
CYORF: PMM0550
UniProt: Q7V2D0
LinkDB All DBs
Position
519087..520502
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPEYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDPEAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTANTPE
ELYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagtatgacgctggggtaaaggagtacagagatacctactggactcctgaa
tatgtccccctcgacactgatttgttagcctgtttcaaatgcacaggccaagaaggtgtc
ccaagagaagaagttgcagcagcggtagcggctgaatcttctactggtacttggtcgact
gtttggtccgagttacttaccgaccttgaattttacaaaggccgttgttatcgaatcgaa
gacgttcctggtgatccagaagccttttatgcatttattgcataccctttagatcttttc
gaagaaggttcaatcacaaacgtattaacctctttagtaggtaacgtatttggatttaaa
gctttaagacatctccgtcttgaagatattagattcccaattgcttttattaagacctgt
ggtggaccacctaacggaatagtagttgaaagagatcgacttaataagtatggaagacca
cttctaggttgtaccatcaaacctaaattaggattgtctggtaagaactacggaagggtt
gtctatgaatgccttagagggggtcttgatctaactaaagatgatgagaatatcaattct
cagccattccaacgttggagagaacgatttgagttcgttgctgaagccgttaaacttgct
cagcaagaaactggagaagtaaaaggtcattatttaaattgcaccgctaatacccctgaa
gaactatacgaacgtgcagagtttgctaaagagcttgatatgccaatcatcatgcatgat
tacataactggtggatttacagcaaatactggccttgcaaactggtgtcgtaaaaatggc
atgcttctgcatatacacagagctatgcacgctgttattgatagacatccaaaacatggt
atccacttcagagttctagcgaaatgtttaagactctctggaggagaccagttacatact
ggaaccgttgttgggaaactagaaggtgatcgtcaaactactcttggttacattgataac
ttaagagaatcatttgttcccgaagacagatcaagaggtaacttctttgatcaagattgg
ggatcaatgcctggagtttttgctgttgcatctggtggtatccacgtttggcatatgcca
gcactgcttgcaatatttggagatgattcttgtcttcaattcggaggaggaactcatggt
catccatggggttcagctgccggagctgctgcaaaccgtgttgcattagaagcttgtgtg
aaagcacgtaatgcaggtcgcgaaatcgaaaaagagagtagagacattctaatggaagct
gctaagcatagtcctgaattagctattgcactcgaaacttggaaagaaatcaagtttgag
tttgataccgttgataagctcgacgttcaaggctaa

DBGET integrated database retrieval system