KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0566Help
Entry
PMM0566           CDS       T00142                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PMM0566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmm02000]
    PMM0566
Enzymes [BR:pmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PMM0566
Transporters [BR:pmm02000]
 Other Transporters
  Pores ion channels [TC:1]
   PMM0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N_4 GST_N Glutaredoxin GST_C_5 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CAE19025
CYORF: PMM0566
UniProt: Q7V2B5
LinkDB All DBs
Position
complement(533102..534340)
Genome map
AA seq 412 aa AA seqDB search
MNNILSWADLSKFKIDDIDRVNGINNSYSNLRLFGHCEKEVELIFYRDRHSWCPYCQKIW
LWLEFKRIPYKVKKINMYCYGQKEKWYLNKVSSGKLPAIELNGKIITESDNIITFLENEY
GTLGSSLLSKDIGEVRNLEREIFRSWCNWLCRKSFSYLDLSFRKKKFRESICKLEKILSL
SKTGFIDSPIHDSEKLEPGTGDIIFIPYMERMNASLSYYKGFDLRNSYPFIDRWLTLFEN
FSAYRGTQGDFHTHSHDLPPQMGGCFKDVNDQQISFSNLIDVGEGLGNLEFNQDIDLGYY
AKFALKRVLKHKDNIINANPYEKDLFEESLRAALTHMITSEINEVPKKAATSINYLKNRI
SVPRDMPVISARILRQSLNKIESTNLNTKIDKIPEKHRYDQDPARFILKKRL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaataacatcttgagttgggctgatttaagtaaattcaaaattgatgatattgataga
gttaatgggataaataattcttattcaaacttaagattatttggccattgcgaaaaagaa
gtcgaactgattttctatagagatcgacattcttggtgcccttactgtcaaaaaatatgg
ttatggcttgaattcaaaaggattccttacaaagtgaagaaaataaatatgtattgttat
ggccaaaaagaaaagtggtatctcaacaaagtaagttctggtaaattgcctgcgatagaa
ttgaatggcaagataataactgaaagtgataacattatcacttttttagaaaatgaatat
ggaacacttggttcctctctattatcaaaggatattggagaagttagaaatttagaaaga
gaaatttttagatcatggtgtaattggctttgcagaaaaagctttagttatttagattta
tcctttcgaaaaaaaaaatttagagaatctatttgcaaattagaaaaaatattaagttta
tccaaaacagggtttattgattcaccaatacatgattcagaaaaattagagccaggtact
ggagacataatttttattccatatatggaaagaatgaatgcttcattaagttattacaag
gggttcgatttaagaaatagttatccttttattgatagatggttaaccctttttgaaaat
ttcagtgcatatagaggtactcaaggtgattttcatactcattcccatgatctacctcct
caaatgggtggctgctttaaggatgttaatgatcaacaaatttccttttctaatctaata
gatgtaggagaagggctagggaacttggaatttaatcaagatattgacttgggttattac
gctaaatttgcacttaaaagagttctaaaacataaagacaatattattaacgctaatcct
tatgaaaaagacttatttgaggaatcattaagggctgctcttacccatatgattacctcc
gaaatcaatgaagttcccaaaaaggcagctacatctatcaactacttaaaaaatagaatt
tctgtgccaagagatatgcctgtaatttctgcaaggatattaagacaatctttaaataaa
attgagtcaacgaatcttaataccaaaatcgataagattccagaaaaacatagatatgat
caagatcctgccagatttatattaaaaaaaagattataa

DBGET integrated database retrieval system