KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM1575Help
Entry
PMM1575           CDS       T00142                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00620  Pyruvate metabolism
pmm00680  Methane metabolism
pmm00710  Carbon fixation in photosynthetic organisms
pmm01100  Metabolic pathways
pmm01120  Microbial metabolism in diverse environments
pmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMM1575 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMM1575 (ppc)
   00680 Methane metabolism
    PMM1575 (ppc)
Enzymes [BR:pmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PMM1575 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAE20034
CYORF: PMM1575
UniProt: Q7UZT0
LinkDB All DBs
Position
complement(1502738..1505707)
Genome map
AA seq 989 aa AA seqDB search
MESMKQFKNNNVDLISNNDPLDKNRALIEDLWESVLREECPDDQANRLIQLKELSYSNKV
EEYSPKNFKTEIVDIVNSMDLAESISAARAFSLYFQLVNILEQRVEEDRYIQSFTNQNVK
KSHDNLDPFAPALARQNAPVTFKELFFRLRRLNVPPGKLEELLQEMDIRLVFTAHPTEIV
RHTIRHKQTRVANLLQKIQVEKFLTIEDIKSLKIQLKEEIRLWWRTDELHQFKPSVIDEV
DYALHYFQQVLFDAMPQLRGRISSALTENYPDVQMPTESFCTFGSWVGSDRDGNPSVTPE
ITWRTACYQRQLMLERYIKATSNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARA
TRYRSEPYRLKLSYILEKLRLTHERNNLLSEGGWKLSLERESDNKNLELVEKLHYKSVDE
FTYDLELIKNSLNSTDLTCEAVNKLLTQVHIFGFSLASLDIRQESTRHSDAIQELTNYLE
LPKQYDQMSEKDRIQWLNEELNTKRPLIPSEVNWNKSTEETFSVFKMVKRLQEEFGSRIC
HSYVISMSHSASDLLEVLLLAKEMGLIDQGSQKSTLLVVPLFETVEDLQRAPDVMEQLFQ
LDFYKSLLPKVGESFKPLQELMLGYSDSNKDSGFLSSNWEIHRAQIALQNLSSRNNILLR
LFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTT
AVIQNSLVNNRLDATPEWNDLMTRLAETSRIQYRKLVHENPNLLTFFQEVTPIEEISKLQ
ISSRPARRKKGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSVELKSDPEQIELLRV
LHQRWPFFRMLISKVEMTLSKVDLEVAKYYVDTLGSKENSKSFEEIFDVISKEYNLTKSL
VLEITGKNKLLESDRDLRSSVNLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFIEDRIE
SKRAYSRSELLRGALLTINGIAAGMRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggaatctatgaaacagtttaaaaataataatgtggatcttataagcaacaatgatccg
ttggataaaaatcgtgcattgatagaagatttgtgggaatctgtattgagggaagaatgt
ccagatgatcaagcaaatcgtttaatacagctgaaggaattaagttattcaaataaagtt
gaagaatatagtcccaaaaattttaaaactgaaatagttgatattgttaattctatggat
ttagctgaatcaatttctgcagccagagctttttcattatatttccagctagttaatatt
ttagaacaaagagtggaggaagatagatatatacagagctttactaatcagaatgttaaa
aaatcacatgataatctagacccatttgctcctgctttagcaaggcaaaatgctcccgta
acatttaaagaattattctttaggcttagaagattaaatgtccccccaggaaaactagag
gaattattacaagaaatggatatccgcttagtttttaccgcacatcctacagagatagtt
agacatacaattaggcataagcaaacaagagtagctaatctgctgcaaaaaatacaagtt
gaaaaatttttaacaattgaagatattaaatctctcaaaatacaactaaaagaagagata
agactttggtggagaacagatgagttacatcaattcaaaccatcagtaatagatgaagtt
gattatgcactacattattttcaacaagtactctttgatgcgatgccccagttaagaggg
agaatttcttcagcccttactgaaaattatccagacgttcagatgccaactgaatctttt
tgtacatttggatcttgggtaggctctgatagggatgggaatccatcagttactcctgaa
attacttggaggactgcctgttaccaaagacaattaatgttagagaggtatatcaaagcg
acctctaatcttagagatcaactaagcgtctcaatgcaatggagtcaagtaagctcatct
cttttggaatcattagaaaccgatagggttaagtttcctgaaatttatgaagcaagggca
acaagatatagatcagagccttatagattgaaattgagttatattttagaaaaattaaga
ttgacccatgaaagaaataatttactatctgaaggtggatggaagttatctttagaaagg
gaatctgataacaaaaatttagagctagttgaaaaattacattacaagtctgttgatgaa
tttacttatgatctagaattaataaaaaatagtcttaatagtacagatttaacttgtgag
gccgtaaataaattattaactcaggtacatatttttggcttttctttagcaagtttggat
atacgtcaggagagtactagacatagtgacgcaatacaagaattaactaattatcttgag
ttgccaaaacaatatgatcaaatgtctgaaaaagatagaatacaatggcttaatgaggaa
ttaaatacaaaaaggcccttgattccctctgaagttaactggaataaaagtactgaagaa
actttctcagtgtttaaaatggtcaaaagattgcaagaagaatttggaagtcgtatttgt
cattcatatgttatttcaatgagtcacagtgcatctgatttgcttgaagtccttctttta
gcaaaagagatgggactaattgatcaaggttctcaaaaatcgacattgttggtcgtccct
ctttttgaaactgttgaagatctgcaaagagcccctgatgtaatggagcaattatttcaa
ttagatttttataagtcattattaccaaaagttggagaaagttttaaacctcttcaagag
ttaatgttaggttattcagatagcaataaagattcaggattcctatctagtaactgggaa
attcatagagctcaaattgctcttcaaaatctttcaagcagaaataatatacttttaaga
ctttttcacggtagaggaggttccgtaggaagaggaggaggtcctgcttatcaagcaata
ttggctcaaccaagtgggacgctcaaaggaagaataaaaattacagaacaaggagaggtt
ttagcttcaaaatatagtcttcctgaattggcattatataatttggagactgttacaaca
gcggttattcagaatagtttggttaacaacagacttgatgctacaccagaatggaatgac
ttaatgactaggttggcagaaacatctagaatccaatatagaaaattagtacatgagaat
ccaaatttgctaactttttttcaagaggttactccaatcgaggaaattagtaaattacaa
atatcaagtagacctgcaagaaggaaaaaaggcgcaaaggatttatcaagtttaagggca
atcccttgggtatttggctggacacagagtagatttcttttgccaagctggtttggagtg
ggtacggctttatctgtagaattaaaatcagatcctgagcaaattgaattacttagagta
cttcatcaaagatggcccttttttagaatgctcatatctaaggtagaaatgacattatct
aaagttgatttagaagtagcgaaatattacgttgacacacttgggagtaaagaaaattca
aagtcgtttgaggagatttttgatgttatctctaaagaatataatcttactaaatcctta
gtgcttgaaataactggtaaaaataagcttctagaatctgatagagatttaagatcatcc
gttaacttaaggaataaaactataattcctttgggatttttacaagtctcacttttaaga
agacttcgagatcaaacaagacaacctccaattagtgagtttattgaggataggattgag
tctaaaagagcttatagtcgtagtgaattattaagaggagcacttttaacaattaatgga
attgcggcagggatgagaaatacaggataa

DBGET integrated database retrieval system