KEGG   Prochlorococcus marinus NATL2A: PMN2A_0264Help
Entry
PMN2A_0264        CDS       T00267                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00970  Aminoacyl-tRNA biosynthesis
pmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PMN2A_0264
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pmn03029]
    PMN2A_0264
Enzymes [BR:pmn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PMN2A_0264
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PMN2A_0264
Mitochondrial biogenesis [BR:pmn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PMN2A_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AAZ57756
CYORF: PMN2A_0264
UniProt: Q46L72
LinkDB All DBs
Position
806150..807610
Genome map
AA seq 486 aa AA seqDB search
MTFEDLRQKLKSGEVSSKELVQEKINRINELDPTLNSFLIVNTELALSKAEHIDKQIASG
DHLPPLSGIPIAIKDNLCTKGIKTTCASKILDNFVPPYESTVTKKLLNAGAIMIGKTNMD
EFAMGSSTETSAFGPTLNPWNITKVPGGSSGGSAASVAAGLCYGSLGSDTGGSIRQPASF
CGVVGMKPTYGRVSRWGLIAFASSLDQVGPFANNVSDAAEILQVISGKDELDSTTVDIPV
PNYLETLSKSIKGMKIGLIDNCFDHEGLATDVKESVLSSASLLENLGAEIVNISCPRFND
GIATYYVIAPSEASANLARYDGVKYGFRAEDEQSLIEMTSKSRALGFGSEVKRRILIGTY
ALSAGYVDAYYKKAQQVRTLIRRDFDDAFKKVDVLLAPTAPTTAFGSGDNIDNPMAMYLS
DLLTIPANLAGLPAISLPCGFDKYGLPIGLQLIGNVFEEGKLFQVANQFEKAAEVYKNRP
KTDFTL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgaagacttacgccagaaattaaaaagtggtgaggtttcttccaaagaactt
gttcaagaaaaaataaaccgaataaatgaattagatccaactctgaattcctttttaatt
gttaatactgagctagctctaagcaaagcagagcatatcgataaacaaatcgcttctggc
gatcatttaccgcctttgtcagggatacccattgctataaaagacaatctttgtacaaaa
ggaattaagacaacttgcgcaagcaagattttggacaactttgtccccccatacgagtca
acagttacaaaaaagcttttgaacgcaggagcaataatgattggcaagacaaatatggat
gaatttgctatggggagctctacagaaacctctgcatttggtcctactttgaatccatgg
aacattacaaaagttccaggaggcagctctggtggtagcgcagcttctgttgctgccgga
ttatgttatggatctctgggttctgatactggcgggtcaatccgacaacctgcttctttt
tgtggcgttgttggcatgaagccaacttatggtcgagtaagtcgatgggggttaatagct
tttgctagttctttagatcaggttggtccatttgcgaataatgtttctgatgcagctgag
attttgcaagttatatctggcaaggatgaattggattcaactactgttgatattcccgtt
cccaattatttagagactctttctaagtcaattaagggaatgaaaataggtttaattgat
aactgctttgatcatgaaggtttagccactgatgttaaagaatctgttcttagctctgcc
tcgctgctagaaaacttaggcgcagaaattgttaatatttcttgtcctcgtttcaatgat
ggaattgctacttattacgttattgccccatctgaagcttcagcgaatttagctagatat
gacggagtcaaatatggattccgcgctgaagatgaacaatctcttatagagatgacctcc
aaaagtcgagcacttggttttggaagtgaagttaaaagaagaattcttattggaacttat
gctctatccgctggttatgttgatgcttactacaaaaaagcccagcaagttcgaactttg
atacgtagagattttgatgatgcttttaaaaaagtagatgttttgttagcgccaacagca
cctactactgcttttggttctggagataatattgataatccaatggcgatgtatctatcg
gatctattaactattccagcaaatttggctggattgcctgcaatcagcctgccgtgtggt
tttgataaatacggtttgcctatagggttgcagctaataggaaatgtttttgaagaaggg
aagctttttcaagtagctaatcaatttgagaaagctgctgaggtttataagaataggcct
aaaacagatttcacgttataa

DBGET integrated database retrieval system