KEGG   Prochlorococcus marinus NATL2A: PMN2A_1020Help
Entry
PMN2A_1020        CDS       T00267                                 

Definition
(GenBank) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00030  Pentose phosphate pathway
pmn00710  Carbon fixation in photosynthetic organisms
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01200  Carbon metabolism
pmn01230  Biosynthesis of amino acids
Module
pmn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pmn_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
pmn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmn_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pmn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMN2A_1020
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1020
Enzymes [BR:pmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PMN2A_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AAZ58510
CYORF: PMN2A_1020
UniProt: Q46J18
LinkDB All DBs
Position
complement(1515918..1516628)
Genome map
AA seq 236 aa AA seqDB search
MDLQNQMKKAVAQAAVDQIQNGMILGLGSGSTAALMIEALAIKIKSGEIKDVVGVTTSFQ
GEVLASELGIPLKSLSSVSEIDLAIDGADEVNPKFQLIKGGGACHVQEKLVAALAKKFIV
VVDSTKLVEKLNLDFKLPVEVLPSAWKQVQKTLINLGGEGNLRMAQKKAGPIVTDQGNLI
LDLTFRNGIDKPELLESQINNIPGVLENGLFVNLTDEVLVGKVESDVVGVESLKKI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggatctccaaaaccagatgaaaaaagcagttgctcaagctgctgtagatcaaattcaa
aacggtatgattctaggccttggctctggttctacagcagctttgatgattgaagctctt
gctataaaaataaaatcaggagaaattaaagatgttgttggagtgactacatcttttcag
ggtgaagttcttgcttctgaattaggcataccacttaaatctctttcatctgtttcagaa
attgatcttgcaattgatggtgctgatgaagttaatcccaaatttcaattaatcaaagga
ggaggagcttgtcatgtgcaggaaaaacttgttgctgctttagctaaaaaatttatagtt
gttgttgactcaactaaacttgttgaaaaattgaaccttgatttcaaattacctgtagag
gttcttccttctgcttggaaacaagtacaaaaaacattaataaatcttggaggagaaggg
aatctaaggatggctcagaaaaaggctggacctatagttactgatcagggaaacttgata
ctggatttaacctttaggaacggtattgataaacctgaactattggaaagtcaaattaat
aatattcccggtgtccttgaaaatggactttttgtaaacctgactgatgaagtattggtt
gggaaagtagaaagtgatgttgttggtgttgaatcacttaaaaagatttag

DBGET integrated database retrieval system