KEGG   Prochlorococcus marinus NATL2A: PMN2A_1147Help
Entry
PMN2A_1147        CDS       T00267                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00620  Pyruvate metabolism
pmn00680  Methane metabolism
pmn00710  Carbon fixation in photosynthetic organisms
pmn01100  Metabolic pathways
pmn01120  Microbial metabolism in diverse environments
pmn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMN2A_1147
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1147
   00680 Methane metabolism
    PMN2A_1147
Enzymes [BR:pmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PMN2A_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 GAPES4
Motif
Other DBs
NCBI-ProteinID: AAZ58637
CYORF: PMN2A_1147
UniProt: Q46IP1
LinkDB All DBs
Position
complement(1632922..1635906)
Genome map
AA seq 994 aa AA seqDB search
MLKNPSNENISNHSTVCVEDQDPGSLLQQRLELVEDLWKTVLKSECPPDQTERLLRLKQL
SDPSKSNQDNSSKAIVQLITKMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESIEKG
KLDTSNYKIDPFAPALASQTAPATFTQLFERLRRLNVPPAQLDGLMREMDIRLVFTAHPT
EIVRHTVRHKQRRVATLLQQLQSNSLISESEKEIFRLQLEEEIRLWWRTDELHQFKPTVL
DEVDYALHYFQQVLFDAMPQLRRRLTTALASSYPDVEIPNEAFCTFGSWVGSDRDGNPSV
TPEITWRTACYQRQLMLDRYIASVQDLRDQLSISMQWSQVSSPLLESLEMDRVRFPEVYE
ERAARYRLEPYRLKLSYTLERLRLTQLRNKQLADAGWQFSPDGKPLISTNNSFDEVLHYK
SVEELKNELELIRNSLVSTDLTCEPLDTLLNQVHIFGFSLASLDIRQESTRHSDALDELT
RYLDLPESYGVMSEESRVQWLMKELRTRRPLIPPSFEWSKSTQETISVFHMLHRLQKEFG
TRICRSYVISMSHTASDLLEVLLLAKESGLIDPTLGASDLLVVPLFETVEDLQHAPSVME
SLLQTDVYRELLPRVGEKKQPLQELMLGYSDSNKDSGFLSSNWEIHKAQIALQDLASRQG
IALRIFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALYNLE
TVTTAVIQNSLVTNKLDATPSWNELMTRLAARSREHYRALVHDNPDLVQFFQVVTPIEEI
SKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALATELKADPDQME
MLRMLNQRWPFFRMLISKVEMTLSKVDLDVAHHYVVSLGGSDDRDAFARIFDIISSEYSL
TKKLILEITGKSKLLSADPALQLSVNLRNRTIVPLGFLQVALLKRLRDQNRQPPISEDVS
IDSTQSSRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatccttctaacgaaaatatctctaatcactcgacagtatgtgttgaggat
caagatcctggatctttattgcaacaaaggcttgaactagtggaggatctatggaaaacc
gttctcaaaagtgaatgtccacctgatcaaacagagagattattgcgattaaaacaatta
agtgatcctagtaagtcaaatcaagacaattcctcaaaggcaatagtccaattgattaca
aaaatggatttggctgaggcgatatctgctgctagggctttttctctttattttcagttg
gtaaacattctggagcaacgcatagaagaggatagttatttagaaagcatagaaaaaggg
aagttagacaccagtaattataaaatagatccattcgctccagctttagctagtcagact
gctccagcaacttttacacaattatttgagcgattacgtcgtttgaatgtccctccagct
cagcttgatggtttgatgagagaaatggatattcgtcttgtttttacagctcatccaact
gaaatagttagacacacggttcgccataagcaacgcagggttgccactcttttgcagcaa
cttcaatctaatagcttgatttccgaatcagagaaagaaatatttaggttgcagctagag
gaggagataagactttggtggagaactgatgagcttcatcaattcaaaccgactgtcctt
gatgaggttgactatgcccttcattattttcagcaggttttgtttgatgcaatgcctcaa
ttaagaaggagactgactaccgcacttgcttcaagttatccagacgtagagatccctaat
gaagctttttgcacatttggctcttgggtaggttcagatcgtgatgggaatccgtcagtt
actcctgaaatcacatggagaacagcgtgttaccaaagacaattaatgttggataggtat
attgcatcagttcaagatctaagagaccaactcagtatatctatgcaatggagtcaagta
agttctcctttgttagagtcattggaaatggacagagttcgtttccctgaggtttatgag
gaaagggctgcaagatatagactggaaccttatcgcttgaagcttagctatacacttgag
aggctacgacttactcaactacgtaataagcagctagcggatgctggatggcaattctca
cccgatgggaaaccgctaatatctactaataatagttttgatgaagtactccactacaaa
tctgtagaagaattaaaaaatgaattagagcttattagaaatagtttggttagtacagat
cttacttgtgaaccattagatactttgctaaatcaagttcatatttttgggttctcgttg
gctagtttagacattaggcaagaaagcacacgacatagtgatgcgttggatgagctcact
cgctatttagatctccctgagtcgtatggagtgatgagcgaggaaagtcgagttcaatgg
ttgatgaaagaattaagaactcggagaccacttatcccgccttcttttgagtggtctaaa
agtactcaagaaactatctcagtttttcatatgcttcataggcttcagaaagaatttggt
actcgtatatgtcgctcgtatgtaatttcgatgagtcatacggcatcagatttattagaa
gttcttcttttagctaaagagtcgggtttgattgatccaactttaggagcttctgatctt
ctcgttgttccattatttgaaacggttgaggacttacaacatgctccttctgtaatggag
tcgttactacaaactgatgtttatcgcgaattacttccacgagtaggagagaaaaaacaa
ccgcttcaggaacttatgctgggatattccgatagtaataaggattctggttttctctca
agtaattgggaaattcataaggcccaaatagcactccaagacctagctagtagacaagga
atagcattacgtatttttcatggtagaggtgggtctgtaggaagaggcggtggaccagct
tatcaagctattttggctcaacctagtggtacacttcagggacgtataaaaataacagag
caaggggaagtacttgcttcaaaatatagtcttccagaattagctttatataatctggaa
actgtaaccactgcagttattcaaaatagcttggttaccaataaattggatgctacgcca
agttggaatgaattgatgaccagacttgcagctcgttcaagggagcattaccgagcctta
gttcatgataatccagatttagttcaattttttcaggtagttactccaatagaagagatt
agtaagttgcaaatttctagtcgtcctgctcgacgaaagagtggtgcaaaagacttatca
agtcttcgagctatcccatgggtctttggttggactcaaagtcgtttccttttgccaagt
tggtttggtgttggtacggctttagctactgaattaaaggctgaccccgaccaaatggag
atgttgcgaatgttgaatcagagatggccattctttagaatgttgatatctaaagtagag
atgacactttcaaaagttgatttagatgttgcccaccattatgtggttagtttgggtgga
agtgatgatcgggatgctttcgctagaattttcgatattatctcaagcgaatacagcttg
actaagaaattaattttagaaattactggcaagtcaaaactattaagtgcagaccctgct
ttgcagttgtctgtcaacctgagaaataggactattgtccctttaggatttttacaagta
gctcttctcaagcgattaagagatcagaatcgtcaaccaccaattagtgaagatgtaagt
attgactctactcaaagttctcgtacatatagtcgtagtgaattattgcgtggtgcattg
ttgactatcaatggtatcgctgcaggtatgagaaacacaggatga

DBGET integrated database retrieval system