KEGG   Prochlorococcus marinus NATL2A: PMN2A_1648Help
Entry
PMN2A_1648        CDS       T00267                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00061  Fatty acid biosynthesis
pmn00780  Biotin metabolism
pmn01100  Metabolic pathways
pmn01130  Biosynthesis of antibiotics
pmn01212  Fatty acid metabolism
Module
pmn_M00083  Fatty acid biosynthesis, elongation
pmn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PMN2A_1648
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PMN2A_1648
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PMN2A_1648
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmn01004]
    PMN2A_1648
Enzymes [BR:pmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PMN2A_1648
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PMN2A_1648
Lipid biosynthesis proteins [BR:pmn01004]
 Fatty acid synthase
  Component type
   PMN2A_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AAZ59136
CYORF: PMN2A_1648
UniProt: Q46H92
LinkDB All DBs
Position
complement(317141..317923)
Genome map
AA seq 260 aa AA seqDB search
MLLDLSGKKILVTGIANNRSIAWGIAQQLKAAGAELGITYLPDEKGRFETKVKELTSPLN
PSLFLPLNVQNSSQIEEVFEAIKNQWGQLDGLVHCLAFAGKEELVGNYSATSSEGFSRAL
EISAYSLAPLCKYAKPLFSKGAGVVTLTYLGAERAIPNYNVMGVAKAALEASVRYLSEEL
GPENQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRRTVTQIEVGNTAAFLLSDL
SSGISGQTVYVDAGYCINGM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcgatcttagtggcaaaaaaatccttgttacaggaatagcaaacaatagatca
attgcctggggcattgcacaacagttaaaagcagctggagctgaattaggaattacatac
ttgcccgatgaaaaaggtagatttgaaacgaaagtaaaagaacttacttctcctttaaat
ccaagcttgttcttaccacttaatgttcaaaattcttctcaaattgaagaagtttttgaa
gccattaaaaatcaatggggtcagcttgatggattagttcactgtctagcctttgcaggt
aaagaagaattagtaggcaattacagtgcaacttcttcagagggattctcaagagcccta
gaaatcagcgcttactcactagccccactatgtaaatatgcaaaacctcttttcagtaaa
ggtgctggcgtagtcaccttgacttatttaggagcagaaagagcaattcccaattacaac
gtaatgggggttgctaaagcagctttggaggcatcggttagatatctttcggaagaactt
ggtcctgagaatcaggttcgagttaatgctatcagtgctggaccaataagaactctcgca
agctcagcgattggaggaattctggacatgattcataatgtcgaagaaaaagctcccctt
aggagaaccgttactcaaatcgaggtaggcaataccgcagctttcttgcttagcgatctt
tcaagtggtatatcaggacaaactgtttatgttgatgcaggttattgcatcaatggaatg
taa

DBGET integrated database retrieval system