KEGG   Prochlorococcus marinus NATL2A: PMN2A_1668Help
Entry
PMN2A_1668        CDS       T00267                                 

Definition
(GenBank) tRNA nucleotidyltransferase/poly(A) polymerase
  KO
K00970  poly(A) polymerase [EC:2.7.7.19]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PMN2A_1668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pmn03019]
    PMN2A_1668
Enzymes [BR:pmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     PMN2A_1668
Messenger RNA biogenesis [BR:pmn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     PMN2A_1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol CD36
Motif
Other DBs
NCBI-ProteinID: AAZ59156
CYORF: PMN2A_1668
UniProt: Q46H76
LinkDB All DBs
Position
complement(335011..336267)
Genome map
AA seq 418 aa AA seqDB search
MELFDKSTIEKEIKELPRGILTIILEAACSVNITSIAIVGGVVRDLIKKSKNQNYEIIFN
DLDLIIEGETSTYIKELQKVLGAERVKVIRDNRNYKTSEVIINGIKVDIASARKETYPIP
GENPIVELSTIKKDLIRRDFNINAMAIELKDNRLIDLFSGSDAIENMKMDFLHKSSVLDD
PTRVIRASRYSAKLDFDLSNQALKQIKDTINLWPWNWHIGDNTDLAPSALSIRLKMELEL
LLEDKYWKNALKNLQVCGGLKIVDSKLQNDKRLIEKIFIAKKSNIEPLTAFVYESKSPIY
LANRLHLNQQQKEIIEGACRLNKYLKNITANHLYKNWSPSKWTINLEKINANESSFMLEI
CRNNPLKEYLKSWLFNWKNIESPIKGDDLIAKGWEPGPEIGIEIKRQRMKLIDENIAF
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaattatttgataaatctacaattgaaaaagagataaaagaattaccgagaggaatt
ctaactattattttagaagcagcttgctcagtcaatataacttctattgcaatagttgga
ggagttgtaagagacttaataaaaaaatctaaaaatcaaaattatgaaattatcttcaat
gatctagatttaattattgaaggtgagacctcaacctatataaaagaattgcaaaaagtt
cttggagcagaaagagtaaaagtcatccgagataacagaaattacaaaacctcagaagta
ataattaatggcataaaagttgatattgcatctgctcgtaaagaaacgtatccaatacct
ggagaaaacccaatagtcgagttatcaacaatcaaaaaagatctaataagaagagatttt
aatataaatgcaatggcaattgaactgaaagataatagactaatcgatttattttcagga
tcagatgcaattgaaaatatgaaaatggactttttgcataaatcaagtgttttagatgac
ccaactagagttattagagcttctcgctattctgccaagttagattttgatctatcaaat
caagccttaaaacaaataaaagatacaataaatctttggccttggaattggcatattgga
gataatactgatttagcaccttcagcattatcaataagattaaaaatggaactagaattg
cttttagaagacaaatattggaagaatgcattaaaaaatctacaagtctgtggagggcta
aaaatagtagattcgaaattacaaaatgataaacgacttattgaaaaaattttcattgca
aagaagtctaatattgaacccctaacagcatttgtttatgaatctaaaagccctatttat
ctagctaatagattacacttaaatcaacagcaaaaagaaataatagaaggagcttgtaga
ttaaataaatatctaaaaaatataacagctaatcatttatataaaaattggtcaccatca
aagtggacaataaaccttgagaaaatcaatgctaatgaatcttctttcatgcttgaaata
tgtagaaataacccactaaaagaatatttgaaatcttggctatttaattggaagaatata
gagtctccaataaaaggagatgatttaatagctaaaggttgggaacctggaccagaaata
ggaatagaaataaaacggcaaagaatgaaattaattgatgaaaatattgctttttaa

DBGET integrated database retrieval system