KEGG   Prochlorococcus marinus NATL2A: PMN2A_1739
Entry
PMN2A_1739        CDS       T00267                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00010  Glycolysis / Gluconeogenesis
pmn00020  Citrate cycle (TCA cycle)
pmn00620  Pyruvate metabolism
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01200  Carbon metabolism
Module
pmn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_1739
   00020 Citrate cycle (TCA cycle)
    PMN2A_1739
   00620 Pyruvate metabolism
    PMN2A_1739
Enzymes [BR:pmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMN2A_1739
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: AAZ59227
CYORF: PMN2A_1739
UniProt: Q46H07
LinkDB
Position
404851..406221
AA seq 456 aa
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKADMDVESFQDGFLASI
VMPAGSSAPVGETIGLIVETSDEIAEAQANAPSPSPQSGSQEKESSSPQVQEKQASVDSP
KATVVTKTSLAPLVSESSVNQDQFLNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQ
AEDVQSAKGQPISVPWIAESNAPAKIISDVPRIEKKSVDSGKPPAPGKSFGSRGETISFN
TLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKSDGVTMTALLAKAVGLTLARHP
QVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADKTSLTDLSLQWADLVKRARNK
QLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAVGASLSKVVASKDGSISIKKQM
QVNLTADHRVIYGADGALFLKDLAYLIENNPCSLSS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggccactcatgacatctttatgcctgctttaagttcaactatgactgagggcaaaata
gttgagtggctaaaaaaacctggagataaagttgaaagaggtgagtcagttttagttgtt
gagtcagataaagctgatatggatgttgagtctttccaagatggctttctcgcttcgatt
gtgatgcctgcaggcagctctgcacctgttggagagacaatcggattgatcgttgagaca
tcagatgagatcgctgaggctcaagcaaatgcaccttctccttcccctcaatcaggtagt
caagaaaaagagagttcatcgcctcaagttcaagaaaaacaagcctctgttgactctcct
aaagcaacagtagttacaaagacatcacttgcacctcttgtttcagaatcctctgtaaat
caggatcagtttttaaatgatggtcgaatagttgcttccccaagagctaaaaaacttgct
tctcaaatgggagtggatttggcaactgttaggggctcaggacctcatggacgaatacaa
gctgaggatgttcaaagtgcaaaagggcaacccataagcgttccttggattgcagaaagt
aatgctccagcgaaaatcatttctgacgtgcctcgcatagaaaaaaaatctgttgactct
ggtaagccacctgctccagggaaaagttttggatctagaggggaaacaatttcattcaac
actcttcaacaagctgtaaatcggaacatggaggaaagtttaaatactccttgtttcaga
gtcggatattcaattcttactgatgaattggatgatctttataaacaagttaaatctgat
ggagtaactatgactgctttacttgctaaagcagttggcttaaccctggctagacacccc
caggtgaatgcagcttttagttctgaggggattgcctatccttcacaaataaatgtagcc
gttgcagttgcgatggaggacggagggttgataactccagtgctgcaaaatgctgataag
acgagccttactgatttatccctacaatgggctgatcttgttaagcgtgcgaggaataag
caattagaaccgcaagaatacagcagtggaacgtttacactctcgaatctaggtatgttt
ggtgtggatcgttttgatgcaattctgcccccagggactggagcaattttagcggtagga
gcttcattgtctaaagttgttgcttctaaagatggttcgatttcaatcaaaaaacagatg
caagtcaatcttaccgctgatcacagagtgatctatggggctgatggagcactattcctg
aaggacttggcttacttaatcgaaaacaacccttgtagcctctcgtcgtga

DBGET integrated database retrieval system