KEGG   Prochlorococcus marinus NATL2A: PMN2A_1739Help
Entry
PMN2A_1739        CDS       T00267                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00010  Glycolysis / Gluconeogenesis
pmn00020  Citrate cycle (TCA cycle)
pmn00620  Pyruvate metabolism
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01200  Carbon metabolism
Module
pmn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_1739
   00020 Citrate cycle (TCA cycle)
    PMN2A_1739
   00620 Pyruvate metabolism
    PMN2A_1739
Enzymes [BR:pmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMN2A_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding FAM104
Motif
Other DBs
NCBI-ProteinID: AAZ59227
CYORF: PMN2A_1739
UniProt: Q46H07
LinkDB All DBs
Position
404851..406221
Genome map
AA seq 456 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKADMDVESFQDGFLASI
VMPAGSSAPVGETIGLIVETSDEIAEAQANAPSPSPQSGSQEKESSSPQVQEKQASVDSP
KATVVTKTSLAPLVSESSVNQDQFLNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQ
AEDVQSAKGQPISVPWIAESNAPAKIISDVPRIEKKSVDSGKPPAPGKSFGSRGETISFN
TLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKSDGVTMTALLAKAVGLTLARHP
QVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADKTSLTDLSLQWADLVKRARNK
QLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAVGASLSKVVASKDGSISIKKQM
QVNLTADHRVIYGADGALFLKDLAYLIENNPCSLSS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccactcatgacatctttatgcctgctttaagttcaactatgactgagggcaaaata
gttgagtggctaaaaaaacctggagataaagttgaaagaggtgagtcagttttagttgtt
gagtcagataaagctgatatggatgttgagtctttccaagatggctttctcgcttcgatt
gtgatgcctgcaggcagctctgcacctgttggagagacaatcggattgatcgttgagaca
tcagatgagatcgctgaggctcaagcaaatgcaccttctccttcccctcaatcaggtagt
caagaaaaagagagttcatcgcctcaagttcaagaaaaacaagcctctgttgactctcct
aaagcaacagtagttacaaagacatcacttgcacctcttgtttcagaatcctctgtaaat
caggatcagtttttaaatgatggtcgaatagttgcttccccaagagctaaaaaacttgct
tctcaaatgggagtggatttggcaactgttaggggctcaggacctcatggacgaatacaa
gctgaggatgttcaaagtgcaaaagggcaacccataagcgttccttggattgcagaaagt
aatgctccagcgaaaatcatttctgacgtgcctcgcatagaaaaaaaatctgttgactct
ggtaagccacctgctccagggaaaagttttggatctagaggggaaacaatttcattcaac
actcttcaacaagctgtaaatcggaacatggaggaaagtttaaatactccttgtttcaga
gtcggatattcaattcttactgatgaattggatgatctttataaacaagttaaatctgat
ggagtaactatgactgctttacttgctaaagcagttggcttaaccctggctagacacccc
caggtgaatgcagcttttagttctgaggggattgcctatccttcacaaataaatgtagcc
gttgcagttgcgatggaggacggagggttgataactccagtgctgcaaaatgctgataag
acgagccttactgatttatccctacaatgggctgatcttgttaagcgtgcgaggaataag
caattagaaccgcaagaatacagcagtggaacgtttacactctcgaatctaggtatgttt
ggtgtggatcgttttgatgcaattctgcccccagggactggagcaattttagcggtagga
gcttcattgtctaaagttgttgcttctaaagatggttcgatttcaatcaaaaaacagatg
caagtcaatcttaccgctgatcacagagtgatctatggggctgatggagcactattcctg
aaggacttggcttacttaatcgaaaacaacccttgtagcctctcgtcgtga

DBGET integrated database retrieval system