KEGG   Prochlorococcus marinus NATL2A: PMN2A_1880Help
Entry
PMN2A_1880        CDS       T00267                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00630  Glyoxylate and dicarboxylate metabolism
pmn00710  Carbon fixation in photosynthetic organisms
pmn01100  Metabolic pathways
pmn01120  Microbial metabolism in diverse environments
pmn01200  Carbon metabolism
Module
pmn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PMN2A_1880
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1880
Enzymes [BR:pmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PMN2A_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AAZ59368
CYORF: PMN2A_1880
UniProt: Q46GN0
LinkDB All DBs
Position
538431..538772
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPVIEHVQPSGSMQTYWS
YWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIVGYDAYTQSQGTCFVVFQGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtaggtgactatcaaacagtcgccaccctggaaacattcggc
ttcttaccgccgatgacccaggacgaaatctacgatcaaatcgcttatatcattgctcag
ggttggagcccggttattgagcatgttcagccaagtggttcaatgcagacttattggtct
tattggaagttacctttctttggcgagaaagatttaaatttggttgttagcgagttagaa
gcttgccatagagcatatcctgaccatcacgttcgtatcgttggatatgacgcgtataca
caaagtcaaggtacttgctttgtagttttccaaggccgctag

DBGET integrated database retrieval system