KEGG   Petrotoga mobilis: Pmob_0315Help
Entry
Pmob_0315         CDS       T00621                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pmo  Petrotoga mobilis
Brite
Enzymes [BR:pmo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pmob_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABX31057
UniProt: A9BEZ3
LinkDB All DBs
Position
complement(337748..338362)
Genome map
AA seq 204 aa AA seqDB search
MAFELPKLSYPYDALEPYIDATTMEIHHTKHHGGYVKNLNAALEKYPEWASKSIEDILKD
LDNIPEDIRTTVRNNGGGHYNHSIFWTIMGPNGGGEPSGKLAESIDKTFGSFDKFKEEFS
NAAVTRFGSGWAWLVLDNYGHLSILSTPNQDNPITYSLKPVLGLDVWEHAYYLKYQNKRP
EYIQAWWNIVNWEAVTKRYEMLLK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccaaaattgagttatccctacgatgctctagaaccttacatagat
gctacaacaatggagattcaccacactaagcatcatggaggttacgttaaaaatttaaat
gctgccttagaaaaatatcctgaatgggcaagcaaaagtatagaagacattctcaaggat
ttagacaatataccagaagatattagaacaacagtaaggaataacggaggcgggcattac
aatcattccatattttggacaataatggggcccaacggtggtggcgaaccttctggaaag
ttagctgaaagtattgataagactttcggaagtttcgacaaatttaaagaggaattttca
aatgctgcagtaacaagatttgggagcggatgggcttggttagtattagataactacggg
catctttcgattctatccacaccgaatcaagataatcctattacatacagtttaaaacct
gtgttaggcttagatgtttgggaacacgcctattatttaaaatatcaaaacaagagaccc
gaatatatacaagcttggtggaacatagttaattgggaagcagttactaaaaggtatgaa
atgttgctaaaataa

DBGET integrated database retrieval system