KEGG   Petrotoga mobilis: Pmob_0381Help
Entry
Pmob_0381         CDS       T00621                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00030  Pentose phosphate pathway
pmo01100  Metabolic pathways
pmo01120  Microbial metabolism in diverse environments
pmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pmob_0381
Enzymes [BR:pmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Pmob_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABX31123
UniProt: A9BF59
LinkDB All DBs
Position
complement(410053..411867)
Genome map
AA seq 604 aa AA seqDB search
MIKGGFKGKLLRVNLTTKEVKSEPLNEEWAQKYLGGRGYGTRLLLEEIDPKVDPLSEENK
VIFATGPLDGTLAPSSGRTMVITKGPLNGAIACSNAGGHFGPALKHTGYDMIVVEGKSAE
PVYIWINKGKVEFRSAKEIWGKLADESDELIREQTHPLAETMTIGPAGEKLSPISSVMFN
GHRASGRTGVGAAVGSKNLKGIAVRGNEDTPVADPEAFMKAVYKARDILSKDAFAGQGAA
MLGTAMLVNVINGVGGFPTRNAQDAYFPEANKISGETLREKNLIRNEGCAECPIACGRVT
VVKSGPYKGTIGGGPEYESVWSFGAMCGVSDLDAVISANHLCDKYGIDTIAMGSTVACAM
ELYEKGYMPKEDAPFELRFGSAEAMLKAVELACKQEGNFGKLLAQGSYRLAEHYGHPELS
MSAKKQEFPAYDPRAIKGMGLEYATSNRGACHVRGYGTAVEVLGDADQYAYEGKAAIIKT
LQDLTGALDSSGICLFTTFGLSANELAEMVSTATGFSIDAQEFMKIGERIWNIEKLFNLK
AGFTRQDDTLPPRILNEPIKTGPSKGQVEDLEKMLDEYYQLRGWDKDSVPTEEKLKELEV
QISK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaggtggattcaaaggtaaattattgagagttaacttaacaaccaaagaagta
aaaagtgaaccattgaatgaagagtgggctcagaaatatttagggggcagagggtatggg
actcgtttgttgttggaagaaatcgatccgaaagtagatcctctctctgaagaaaacaag
gtcatttttgccactggtcctttagatggaacattagctccttcttctggaagaactatg
gtaatcacaaaaggtcctttgaatggagctattgcgtgctctaatgcaggtggacatttt
ggccccgctttgaaacacacaggatacgatatgatcgttgttgaaggaaaatcagccgaa
cccgtatatatatggattaacaaaggtaaagtagaattcagatccgcaaaggaaatatgg
gggaaattggctgacgaaagtgacgaattgataagagagcaaacacatcccttggctgaa
accatgacgattggaccggctggcgagaaattatctcctatctctagcgtaatgttcaat
ggtcatagggcttctggaagaaccggtgttggcgccgcagttggaagcaagaacctaaaa
gggatagccgttagagggaatgaagatactccagtggctgatcctgaagcttttatgaaa
gcagtttataaggctagagatattttaagcaaagatgcctttgcaggtcaaggggctgct
atgttaggtaccgcaatgttggtgaatgttatcaatggtgttggtgggttccccactcgt
aatgcccaagatgcttatttcccagaggcaaataaaattagtggagaaactctaagggag
aaaaatttaattagaaatgaaggatgtgctgagtgtccaatagcttgtggtagggtaacg
gtagtaaaaagtggaccgtataaaggaactattggaggaggtccagaatacgaatcagtt
tggtcgtttggtgcaatgtgtggtgtttcagaccttgatgcagtgataagtgcaaatcat
ctttgtgataaatatggaatcgatactatcgctatgggttcaacggtcgcctgtgccatg
gaattgtacgaaaaaggatatatgcccaaggaagatgccccttttgaacttagatttggt
tcagcagaagctatgttaaaagccgtggaattggcgtgcaagcaagaaggaaattttggg
aaattattagctcaaggttcctatcgcttagcagagcattatggtcatccggaactttct
atgtcggcaaagaaacaggagttcccagcttacgatccaagggctatcaaaggtatgggt
ttagaatatgcaactagcaatcgtggtgcttgccacgtcagaggatatggaacagccgta
gaggtattgggagatgctgatcagtacgcttatgaaggcaaagcggctataattaaaacc
ttacaagatttaaccggtgcacttgattcttctggaatatgtttgttcacgacttttggt
ctcagtgctaatgagttagccgagatggtgtcaactgcaacaggtttttcaatagatgcc
caagagttcatgaaaattggagaaagaatttggaatattgaaaagcttttcaatcttaaa
gctggttttacaagacaggatgataccttacctccaagaatattaaatgaaccaatcaaa
acgggtccttcgaaaggacaggtagaagatcttgaaaagatgctggatgaatactatcag
ttaagaggatgggataaagacagtgttcccacagaagaaaaacttaaagaattggaggtc
cagatttcaaaatga

DBGET integrated database retrieval system