KEGG   Pseudomonas monteilii SB3078: X969_06565Help
Entry
X969_06565        CDS       T02972                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00071  Fatty acid degradation
pmon00280  Valine, leucine and isoleucine degradation
pmon00281  Geraniol degradation
pmon00310  Lysine degradation
pmon00362  Benzoate degradation
pmon00380  Tryptophan metabolism
pmon00410  beta-Alanine metabolism
pmon00640  Propanoate metabolism
pmon00650  Butanoate metabolism
pmon00903  Limonene and pinene degradation
pmon00930  Caprolactam degradation
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01120  Microbial metabolism in diverse environments
pmon01130  Biosynthesis of antibiotics
pmon01200  Carbon metabolism
pmon01212  Fatty acid metabolism
Module
pmon_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    X969_06565 (fadB)
   00650 Butanoate metabolism
    X969_06565 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X969_06565 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X969_06565 (fadB)
   00310 Lysine degradation
    X969_06565 (fadB)
   00380 Tryptophan metabolism
    X969_06565 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    X969_06565 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    X969_06565 (fadB)
   00281 Geraniol degradation
    X969_06565 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X969_06565 (fadB)
   00930 Caprolactam degradation
    X969_06565 (fadB)
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     X969_06565 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     X969_06565 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     X969_06565 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     X969_06565 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AHC81647
LinkDB All DBs
Position
1403797..1405944
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPQLLMAGALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEAQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVADATVLDVLKPIVFEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgcctgaccctgaacgaactg
cgccaggccgtcgatgccatcaaggccgacgcctcggtcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cccgaggccgaactggtcgccggcaacctggaagccaatcgcattttcaacgccttcgaa
gacctcgaagtgccgaccgtcgccgccatcaacggcatcgccctgggcggcggcctggaa
atgtgcctggccgccgactaccgggtcatgtccaccagcgccaagattggcctgccggaa
gtcaaactgggtatctacccgggcttcggcggtaccgtgcgcctgccgcgcctgatcggt
tcggacaacgccatcgaatggatcgccgccggcaaggaaaaccgtgccgaggacgccctg
aaagtgggtgccgtcgacgccgtggtcgcgcctcaactgctgatggccggtgcccttgac
ctggtcaagcgcgccatcagtggcgagctggactacaaggccaagcgccagcccaagctg
gaaaagctcaagctcaatgccatcgagcagatgatggccttcgagactgccaagggcttc
gtcgccggccaggccggccctaactacccagccccggtcgaagccatcaagaccatccag
aaggctgccaacttcggtcgtgacaaggccctggaagtggaagccgcaggcttcgccaag
ctggccaagacctcggttgccgaaagcctgatcggcctgttcctcaacgaccaggaactc
aagcgcaaggccaaggcgcatgacgaaatcgcccacgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggtggcggcatcgcctaccagtcggcggtcaagggcaccccgatc
ctgatgaaggatatccgcgaggaagccatccagctgggcctgaacgaggcctccaagctg
ctcggcaatcgcgtcgagaagggccgcctgaccccggccaagatggccgaggcactcaac
gccattcgcccgaccctgtcctatggcgatttcgccaatgtcgacatcgtcgtcgaggcc
gtggtcgaaaacccgaaagtcaagcaggccgtgctggctgaagtggaagcccaggtgaag
gacgatgcgatcctcgcttccaacacctcgaccatttccatcaacctgctggccaaggcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtcatccgtggcgagaagtccagtgaagtggcggttgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggcttcctggtc
aaccgcgtgctgttcccgtacttcggcggcttcgccaagctggtaagcgccggtgtcgac
ttcgtgcgtatcgacaaggtcatggaaaagttcggctggccgatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggccgcgacgtgatggccgaaggcttc
ccggaccgcatgaaggacgagcgccgctcggccgttgacgcactttacgaggccaaccgc
ctgggccagaagaacggcaagggcttctacgcctacgaaaccgacaagcgcggcaagccg
aagaaggtcgccgacgccaccgtgctcgacgtgctcaagccgatcgtcttcgagcagcgt
gaagtcaccgacgaagacatcatcaactggatgatgatcccgctgtgcctggagaccgtg
cgctgcctggaagacggcatcgtcgaaaccgctgccgaagccgacatgggcctggtctac
ggcattggcttccctcccttccgcggtggtgcgctgcgctacatcgactcgatcggtgtg
gccgaattcgttgccctggccgatcaatacgccgacctggggccgctgtaccacccgacc
gccaagctgcgtgaaatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system