KEGG   Pseudomonas monteilii SB3078: X969_21435Help
Entry
X969_21435        CDS       T02972                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00473  D-Alanine metabolism
pmon00550  Peptidoglycan biosynthesis
pmon01100  Metabolic pathways
pmon01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X969_21435
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X969_21435
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    X969_21435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmon01011]
    X969_21435
Enzymes [BR:pmon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     X969_21435
Peptidoglycan biosynthesis and degradation proteins [BR:pmon01011]
 Precursor biosynthesis
  Amino acid ligase
   X969_21435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_Ter RimK ATPgrasp_YheCD GARS_A TTL ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AHC84401
LinkDB All DBs
Position
complement(4557640..4558596)
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALTTAGVDVVAIDVGDD
LLDRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCLQASTELGFPLIVKPAHEGSSIGMAKVNSAQELVAAWQDAAK
YDSQVLVEQWIHGPEFTVAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaaactgcactcgaccctggacgtcaaggcgttcggccgcgtc
gcggtgctgtacggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcgccgca
gtgatcgacgcgctgaccaccgccggtgtcgacgtggtcgccatcgacgtgggagacgac
ctgctcgaccgcctgcaaagcgagaagatcgaccgcgccttcatcattctccacggtcgt
ggcggtgaagacggcagcatgcaaggcctgctcgagtgcctgggcattccctataccggc
agtggcatccttgcttcggcactggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggcattccgactccgcgccacgcagtgctggcgagcgaaagcgattgtttgcag
gccagtacggaactgggcttcccgcttatcgtcaaacccgcccatgaaggttccagcatc
ggcatggccaaggtgaacagcgcccaggaactggtcgccgcctggcaggacgcagctaaa
tacgattcccaggtactggtggagcagtggatccacgggccggagttcaccgtcgcggta
ttgcgcggccaggtgctgccgccgatcgccctgggtacgccgcacgtgttctacgactac
gacgccaagtacatcgccaacgatacccagtaccgcattccgtgcggcctggacagcgtc
aaggaacaggaactgatcgacctgaccgcgcgtgcctgcgatgccatcggcatcgaaggc
tgggggcggctggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcacccggcatgactgaccatagcctggtgcccatggcggcccgcgcggccggcctg
gacttccagcaactggtgctggcaatcctggccgagagcgtggcgacgcgaggttaa

DBGET integrated database retrieval system