KEGG   Pseudomonas soli: O165_012845Help
Entry
O165_012845       CDS       T03276                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmos  Pseudomonas soli
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O165_012845
Enzymes [BR:pmos01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     O165_012845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO Glutaredoxin FAD_binding_3 NAD_binding_7 K_oxygenase FMO-like Thi4 NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AIN59115
LinkDB All DBs
Position
complement(2706984..2708546)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIAGLSNLITFSADGADTR
RPSFSLNRPGSDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQDEVEARKVMAVPSIYLNGEVF
GQGRMGLEEILGKIDTNSGARQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPAGDGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQQYRARGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGVVAQVTLIEFDSKLRADAVLQRKLHSLPNVKVITSALTTEVVGDGE
KVTGLRYKDRSTEALHDLALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcctccctcgacgacggcgcgaagtcccgcgaattgcacgacctgttg
gtggaaatcgccggcctgtcgaacctgattaccttcagcgcggacggcgccgacacccgt
cgcccttcgttctcgctgaaccgcccagggtctgatatcagcctgcgcttcgccggcatc
cccatgggccacgaattcacctccctggtgctggcgctgctgcaagtcggtggccacccc
tccaaggccagtgccgaagtgatcgagcagatccaggcgctggaaggcgagttcaccttc
gagacctacttctcgctgtcgtgccagaactgcccggacgtggttcaggcgctgaacctg
atggcggtgctcaaccccaatgtgcgccacgtcgccatcgacggcgcgttgttccaggat
gaagtcgaagcccgcaaggtcatggctgtgccgagcatctacctgaacggcgaagtgttc
ggccagggccgcatgggcctggaagagattcttggcaagattgacaccaattccggcgcc
cgccaggccgagaagatcaatgccaaggacgccttcgacgtgctggtggtcggcggtggc
ccggccggtgccgctgcagcgatctacgccgcgcgcaaaggcatccgtaccggtgttgct
gccgagcgtttcggcggccaggtgctcgacaccctggccatcgagaacttcatttcggtg
caggaaaccgaagggccgaagctggccacggccctggaagaacacgtcaagcagtacgac
gtcgacatcatgaacctgcagcgcggcgaagcgttgatcccggccggcgacggcggcctg
cacgaagtgcgcctggccggcggcgcctcgctcaaggccaagaccgtgatcttggctacc
ggtgcccgctggcgtgaaatgaacgtgccgggcgagcagcaataccgcgctcgcggcgtg
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggt
ggcggcaactccggcgtggaagcggccatcgacctggctggtgtcgttgcccaggtgacc
ctgatcgagttcgacagcaagctgcgtgccgacgccgtgttgcagcgcaagctgcacagc
ctgccgaacgtcaaggtgatcaccagcgcgctgaccaccgaagtggtcggcgacggtgaa
aaggtcaccggcctgcgctacaaggaccgcagcaccgaggcgctgcatgacctggcgctg
gaaggcatcttcgtgcagatcggcttgctgcccaacaccgactggctcaagggcaccgtg
gagctgtcgccgcgcggcgagatcatcgtcgacgccaagggccagaccagcatcccgggt
gtgttcgccgccggtgacgtgaccacggtgccgtacaagcagatcgtcatcgccgtgggc
gagggcgccaaggcttcgctggccgccttcgatcacttgatccgcacttcggccccggcc
tga

DBGET integrated database retrieval system