KEGG   Pseudomonas mosselii: O165_014465Help
Entry
O165_014465       CDS       T03276                                 

Definition
(GenBank) glutathione metabolism protein
Organism
pmos  Pseudomonas mosselii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG DUF4027
Motif
Other DBs
NCBI-ProteinID: AIN59418
LinkDB All DBs
Position
complement(3038011..3038442)
Genome map
AA seq 143 aa AA seqDB search
MSGALAVYACCVVVLFFKMLAISCYQGYFRLRFLTFTNSEDAAVFKRSACPEELPQVTRA
MQAWRNDLENIPMFLALGGLAVVLEAPVAMTAWLSGAFTVARVSHTVTYLAGIQPWRTVS
YGVGVICLIGLATLVIEALASTP
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccctggcggtctacgcctgctgcgtagtggtgctgttcttcaagatgctg
gcgatttcctgctaccagggctacttccgcctgcgtttcctgaccttcaccaacagcgag
gatgcggcagtgttcaagcgttcggcttgccctgaggaattgccgcaggtaacgcgggcc
atgcaggcctggcgcaacgatctggagaacatcccgatgttcctcgcgctgggcggcctg
gcggtcgtgctggaggcgccggttgccatgacggcttggctgagcggggcattcaccgtg
gccagggtgtcgcatacggtgacttacctggcgggtatccagccgtggcggacggtgagt
tatggcgtgggggtaatctgtttgatcgggttggcgaccttggtcatcgaggcgctggca
tcgacgccttga

DBGET integrated database retrieval system