KEGG   Pseudomonas mosselii: O165_017190Help
Entry
O165_017190       CDS       T03276                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmos  Pseudomonas mosselii
Pathway
pmos00620  Pyruvate metabolism
pmos00680  Methane metabolism
pmos01100  Metabolic pathways
pmos01120  Microbial metabolism in diverse environments
pmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O165_017190
  09102 Energy metabolism
   00680 Methane metabolism
    O165_017190
Enzymes [BR:pmos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     O165_017190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIN59932
LinkDB All DBs
Position
complement(3632811..3635438)
Genome map
AA seq 875 aa AA seqDB search
MSDIDLRLREDVHLLGELLGETIRQQHGEAFLQKIEDIRHSAKADRRGAGEQLSSTLGDL
AEQDLLPVARAFNQFLNLANIAEQYQLIRRRDAGQPEPFEARVLPELLARLKAAGHGNDE
LARQLGKLNIELVLTAHPTEVARRTLIQKYDAIAAQLAAQDHRDLIPAERQQVRERLRRL
IAESWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAVPSHLRKVDAALFEATGLHLPLEAA
PIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLFLRDIDYLAAELSMQQASAALKE
KVGDSAEPYRALLKQLRDRLRATRAWAHASLAATQPASAAVLVDNRDLIAPLELCYQSLH
ECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDAARHRDALSEITDYLGLGRYAEWDEE
RRITFLQTELKNRRPLLPAHFQPQADTAEVLATCREIAVAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMERLLGLPGYRAGLHGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICREHQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
GGRFRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPEPAWRVLMDQLAADG
VKAYRAVVRENPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWETALSNALARGQGALLAQMREQWPFFRTRIDMLEMVLAKADAQIAEAYDER
LVQPELLPLGAHLRDLLSQSCQVVLGLTGQSVLLAHSPETLEFIRLRNTYLDPLHRLQAE
LLARSRSREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatcgatctgcgcttgcgcgaggatgtgcaccttttgggagaactgcttggc
gagactatccgccagcagcatggcgaggcattcctgcagaagatcgaggatatccgccac
agcgccaaggccgaccgccgtggagcgggcgagcaactgagctcgaccctgggcgacctg
gccgagcaagacctgctgccggtggcgcgggcgttcaaccagttcctcaacctggccaac
atcgccgagcagtaccagctgatccgccgccgtgacgctggccaacccgaaccgttcgag
gcgcgggtgctccccgagttgctggcgcgcctgaaggccgctggccatggcaacgatgag
ctggccaggcaactgggcaagttgaacatcgaactggtgctcaccgcgcaccccaccgag
gtggcgcgccgcaccttgatccagaagtacgacgccattgccgcgcagctggccgcgcag
gatcaccgcgacctgatcccggccgagcgccagcaggtgcgcgaacgcctgcgccggctg
atcgccgaatcctggcacaccgaggaaatccgcaggacccggcccacaccggtggacgag
gccaagtggggcttcgccgtgatcgagcactcattgtggcaggctgtgcccagccacctg
cgcaaggtcgatgcggctctgttcgaggcgaccggcctgcacctgccgctggaggcggcg
ccgattcgcttcgcctcgtggatgggcggtgatcgtgacggcaatcccaatgtcacggcg
gcggtaacccgcgaagtgctcttgctggcgcgctggatggccgccgacctgttcctgcgc
gatatcgactacctggccgccgagctgtccatgcagcaggccagcgccgcgctcaaggaa
aaggtcggggacagcgccgaaccataccgggcgctgctcaagcagttgcgcgaccgcctg
cgtgccacccgcgcctgggcccacgcctcgttggccgcgacgcagccggccagcgcggcg
gtgctggtggacaatcgcgacctcatcgcgccgctggagctgtgctaccagtcgctgcat
gagtgtggcatgggcgtgatcgccgacggcccgttgctcgactgcctgcgccgggcggtg
acctttggtctgttcctggtgcgtctggacgtgcgccaggacgctgcccgtcatcgcgat
gcgctgtcggaaatcaccgactacctcggcctcggccgctacgccgagtgggacgaagag
cgacgcatcacgttcctccagaccgaactgaagaaccgccgcccgttgctgccggcgcat
ttccagcctcaggccgataccgccgaagtactcgccacctgccgcgaaatcgctgtggcc
ccggcggcgtcgctggggtcgtacgtgatttccatggccggcgcggcgtccgacgtgctg
gcggtgcagttgttgctcaaggaggccgggctgacccggccgatgcgcgtggtacccctg
ttcgagaccctggccgacctggacaacgcaggcccggtcatggagcgcctgctcgggcta
cccggctatcgcgccggcctgcacggcccgcaagaggtaatgatcggctattccgactcg
gccaaggatgccggcaccacagcggcggcctgggcccagtaccgcgcccaggaaaacctg
gtacgtatctgccgtgagcaccaggtcgagctgctgctgttccatggtcgcggtggcacg
gtcgggcgtggcggcggcccagcccacgcggcgatcctgtcgcagccgccggggtcggtg
ggtggccgtttccgcaccaccgaacagggcgagatgatccgcttcaagttcggtctgccg
ggcatcgccgaacagaacctcaatctttacctggccgcggtgctggaggcgaccctgttg
ccaccgccgccgcctgagccggcctggcgcgtactgatggaccagctggccgccgacggg
gtcaaggcctaccgggccgtggtgcgcgaaaatccggacttcgtcgagtacttccgtcag
tccacccccgagcaggagcttggccgcctgccgctgggcagtcgcccggccaagcgccgc
gccggcggcatcgaaagcctgagggcgatcccttggatcttcggctggacccagacacgg
ctgatgctgccggcctggctcggctgggagaccgcgctgagcaatgccctggcacgcggg
cagggggcgctgctggcgcagatgcgcgaacagtggccattcttccgcacccgcatcgac
atgttggaaatggtcctggccaaggccgatgcgcagatcgccgaggcctacgacgaacgt
ctggtgcaacccgaactgctgccgttgggcgcgcacctgcgcgacctattgtcgcagtcg
tgccaggtggtactggggctgaccgggcagtcggtgctactggcgcacagcccggaaacc
ttggaattcatccgactgcgcaacacctacctggacccgctgcaccgcctgcaggccgag
ttgctggcacgctcgcgcagccgcgaagccgctctggacagcccgttggagcaggccttg
ctggtgacggtggccgggatcgcagcggggctgcgcaataccggctga

DBGET integrated database retrieval system