KEGG   Pseudomonas soli: O165_025355
Entry
O165_025355       CDS       T03276                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
pmos  Pseudomonas soli
Pathway
pmos02025  Biofilm formation - Pseudomonas aeruginosa
pmos03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    O165_025355
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    O165_025355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmos02044]
    O165_025355
Secretion system [BR:pmos02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O165_025355
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_22
Other DBs
NCBI-ProteinID: AIN61473
LinkDB
Position
5439553..5443059
AA seq 1168 aa
MKAFFSFVIRWVVPLLGLLALSLIIWFLGPLLDMLVPAAPRLVLIGLLFTVWIAYRVWRI
VQARRQAAKVMQSLAAETAADPASVATAEELATLRQRMDEALVLLKKARLGGDERRNLYE
LPWYVIIGPPGSGKTTALVNSGLHFPLAAQLGEGAIRGVGGTRNCDWWFTDQAVLLDTAG
RYTTQDSHAQVDKAAWLGFLDLLKSQRSRRPIDGAFIAISLSDLLLGSDAERAAHAAAIR
TRIQELYSQLGVRFPIYLMLTKLDLVPGFMEFFDTLSKEERAQVWGMTFPLDDGQQGDGP
LAQFGNEFALLEQRLNQRLVERLQQERDPARRDLVYGFVQQFAALRGNLKTFLDGIFKPN
AFEERALLRGVYFTSGTQEGSPIDRLIGSMAQSMGLDRAHLARQNGTGRSYFIEKLFSAV
AFAERGLVGSNPKIEQRRKWIARGALALSVALVLVVGTLWTLSYRANQQYIAEVDSRLKP
LGKSVQELSPAQRNVVEVLPLLNGVRRLAEDPPGWAEGLGLYQGDMLEGESDSVYRKLLI
AIFAPRLVTRIEEQLYGGGPSDYLYEGLKAYLMLADGEHYDAEFIKAWVTLDWERSLPRD
LAPDLRQALEQHLAALFDKRPPNARLDQRLIDDTRRQLQQLPVAQRVYDRVKRQKLPAGV
SDFRVSDAAGRDAALVFRFKDGKPLSEPLPGIFTVEGYRKAFLAASLAHSETLAEERWVL
GREASESADAKRLADDVLQLYYQDYIRHWDALLADLDFVPITSVGQAADVLRVLSGPTSP
MKKLLQAVAKETNLEQPTTLDKVQAKAEQAGVDQLRQRLGGLLGDAPLPSDNPAAREVDP
VTAHFAELAALVETGEGQPAAIDGLLTDLNALYVQVSAMVGASGDALLGEAKNQAQAAAQ
RVALGAARQPKVVQNLVSSVLGSTHNLVMGGVRNQLNAAWTSEVVNVYRQSLSGRYPLVA
GSSRDATLEDFGLFFGVGGVMDNYFRKYLQPYVNTSSTPWSWQPGAAQKLGINSNVLYTF
QRAASIRDAFFRNSNGVQPGVRFELKPVAMDATITQFLLDLDGQQVSYDHGPSRPVALQW
PNPNSIGVVRLSISPPSASGRSGLTVEGPWAWFRLLDQSDLVAGGSPERFNLRLRVDGAS
VSYELRASSAFNPFRSRVLSGFSLPEHL
NT seq 3507 nt   +upstreamnt  +downstreamnt
gtgaaggcgtttttcagttttgtcattcgctgggtagttccgctgctgggcctgctggcc
ctgagcctgatcatctggttcctcggcccactgctggacatgctggtgcctgccgctccg
cgcctggtgcttatcggcctgttgttcacggtgtggatcgcctaccgcgtgtggcgcatc
gtccaggcccgccgtcaggcggccaaggtcatgcagagcctggccgcagagaccgcggca
gaccccgccagcgtggccaccgccgaagagctggcaaccctgcgccagcgcatggacgaa
gccctggtgctgctgaagaaggcacgcctgggcggcgacgagcgacgcaacctgtatgaa
ctgccgtggtacgtgatcatcggcccgcccggctcgggcaagaccaccgcgctggtcaat
tccggcctgcacttcccgctggcggcgcagctgggcgagggcgccatccgtggggttggc
ggtacgcgcaactgcgactggtggttcaccgaccaggccgtgctgctggacaccgccggc
cgctacaccacccaggacagccatgcccaggtggacaaggcggcctggctgggcttcctc
gacctgctcaagagccaacgctcacgccgccccatcgacggcgcgttcatcgccatcagc
ctgtccgacctgctgctgggcagcgacgccgagcgcgctgcccacgcggcagcgatccgt
acccgcatccaggagctgtacagccagctgggcgtgcgcttcccgatctacctgatgctg
accaagctcgacctggtgccggggttcatggagttcttcgacaccctgagcaaggaagag
cgcgcacaggtatggggcatgaccttcccgctcgacgacggccagcagggcgacgggccg
ctggcgcagttcggcaatgaattcgccttgctggagcagcgcctgaaccaacgcctggtc
gagcgcctgcagcaggagcgcgatccggcgcggcgcgacctggtctacggtttcgtccag
cagttcgccgccttgcgcggcaacctgaaaaccttcctcgacggcatcttcaagcccaac
gccttcgaagagcgtgcgctgctgcgcggtgtgtatttcaccagcggtacccaggaaggc
agccccatcgaccgcctgatcggcagcatggcccagagcatgggcctggaccgtgcccat
ctggcacgacagaacggcaccgggcgcagctacttcatcgagaagctgttcagcgccgtg
gccttcgccgagcgtggcctggttggcagcaacccgaagatcgagcagcggcgcaagtgg
atcgcccgtggcgccctggccctgagcgtggccctggtgctggtggtcggtaccctgtgg
acactgagctaccgcgccaaccagcaatacatcgccgaggtcgacagccgcctcaagccg
ctgggcaagagcgtgcaggagctgagcccggcgcagcgcaacgtggtcgaggtgctgccg
ctgctcaatggcgtgcgccgcctggccgaggatccgcccggctgggccgagggcctgggg
ctgtaccagggcgacatgctcgaaggcgagtcggacagcgtctaccgcaagctgctgatc
gccatcttcgccccgcgcctggtcacccgcatcgaggagcagctgtatggcggtggtccg
tccgactacctctacgaggggctcaaggcctacctgatgctggccgacggcgaacactat
gacgccgagttcatcaaggcctgggtcaccctcgactgggagcgcagcctgccgcgcgac
ctggccccggacctgcgccaggccctggagcagcacctggcggcgctgttcgacaagcgt
ccgccgaacgcccgcctggaccagcgcctgatcgacgatacccgccgccagctgcagcaa
ctgccggtggcgcaacgggtctacgatcgggtcaagcgccagaagctgcccgccggggtc
agcgacttccgcgtcagcgatgccgccgggcgtgacgccgcgctggtgttccgcttcaag
gacggcaagccgctgagcgaaccgctgccgggcatcttcactgtcgagggctaccgcaag
gccttcctcgccgccagcctggcccacagcgagaccctggccgaggagcgctgggtgctg
ggtcgcgaggccagcgaatcggccgatgccaagcgcctggccgacgatgtgctgcagctg
tactaccaggactacatccgccattgggatgccttgctggccgacctggacttcgtgccg
atcaccagcgtcggccaggccgccgatgtgctgcgggtgttgtccgggccgacttcgccg
atgaagaagctgctgcaggcggtcgccaaggagaccaacctggagcagccgaccaccctc
gacaaggtccaggccaaggctgaacaggcgggcgtcgatcaactgcgccagcgcctcggc
ggcctgctcggcgatgccccgttgcccagcgacaacccggccgcccgcgaggtggacccg
gtcaccgcgcacttcgctgaactggccgcgctggtggaaaccggcgaaggccagcctgcg
gccatcgacggcctgcttaccgacctcaatgccctgtacgttcaggtcagcgccatggtc
ggcgccagtggcgatgcgctgctgggcgaggccaagaaccaggcccaggctgcggcgcag
cgtgttgccctgggggccgcgcgtcagccgaaggtggtgcagaacctggtgagctcggtg
cttggctcgacccacaacctggtcatgggcggggtgcgcaatcagctcaacgccgcctgg
accagcgaggtggtgaacgtctatcgccagtccctcagcggtcgctatccgttggtggcc
ggcagctcgcgggatgcgaccctggaggacttcggcctgttcttcggcgtcggcggggtg
atggacaactacttccgcaagtacctgcaaccctacgtcaacacatccagcaccccctgg
agctggcagccgggcgcggcgcagaagctggggatcaacagcaacgtgctgtacaccttc
cagcgcgcggcgagcatccgtgacgcgttcttccgcaacagcaacggcgtgcagccgggg
gtgcgcttcgagctcaagccggtggcgatggacgcgaccatcacccagttcctgctcgac
ctcgacggccagcaggtgagctacgaccacggcccgagccggccggtggcgttgcagtgg
ccgaaccccaacagcattggcgtggtgcgcctgtcaatctcgccgccctcggccagcggt
cgttcggggctgaccgtggaggggccgtgggcctggttccgcctgctcgaccagtccgac
ctggtggccggtggctcgccggagcgcttcaacctgcgcctgcgcgtcgacggcgccagc
gtgtcctacgagctgcgtgccagcagcgccttcaacccgttccgcagccgagtgctcagc
ggtttcagcctgccggagcatctgtga

DBGET integrated database retrieval system