KEGG   Pseudomonas soli: O165_028780Help
Entry
O165_028780       CDS       T03276                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pmos  Pseudomonas soli
Pathway
pmos00970  Aminoacyl-tRNA biosynthesis
pmos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O165_028780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pmos03029]
    O165_028780
Enzymes [BR:pmos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     O165_028780
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     O165_028780
Mitochondrial biogenesis [BR:pmos03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    O165_028780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase RDM
Motif
Other DBs
NCBI-ProteinID: AIN62129
LinkDB All DBs
Position
complement(6189332..6190783)
Genome map
AA seq 483 aa AA seqDB search
MHQLTLAEIARGLADKSFSSEELTGALLSRIKQLDPQLNSFITVTEAQALDQARAADARR
ASGETGALLGAPIAHKDLFCTNGVRTSCGSKMLDSFTAPYDATVVAKLAEAGMVTLGKTN
MDEFAMGSANESSHYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPATTGTDTGGSIRQPA
AFTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLQGMAGFDAKDSTSVDE
PVPDFSANLNASLQGLRIGLPKEYFGAGLDPRIADLVQASVKELEKLGAVVKEISLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGHRCEDPKDLTDLYKRSRGEGFGAEVQRRIMVGT
YALSAGYYDAYYVKAQQIRRLIKNDFMAAFADVDVILGPTTPNPAWKLGAKSSDPVAAYL
EDVYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNIAHRYQQVTDWHTRAP
NGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaactcactctggccgaaatcgcccgcggcctcgccgacaagtcgttctcctcg
gaagaactgaccggcgccctgctgtcgcgcatcaagcagctcgacccgcagctcaacagc
ttcatcaccgtcaccgaagcacaggccctggaccaggcgcgcgccgccgacgcccgccgt
gcctctggtgagaccggcgcgctgctgggtgcgccgatcgcccacaaggacctgttctgc
accaacggcgtgcgcaccagctgcggctcgaagatgctcgacagcttcaccgccccgtac
gacgccaccgtggtcgccaagctggccgaagccggcatggtcaccctgggcaagaccaac
atggacgaattcgccatgggctcggccaacgagtccagccactacggcgcggtgaagaac
ccgtggaacctcgagcacgtgcccggcggttcctccggcggctcggccgccgccgtggcc
gcgcgcctgctgccggccaccaccggcaccgacaccggcggttctatccgccagccggca
gccttcaccaacctgaccggcctcaagccgacctatggccgcgtatcgcgctggggcatg
atcgcctacgcctcgagcctcgaccagggcggcccgctggcccgtaccgccgaagactgc
gccctgctgctgcaaggcatggccggcttcgacgccaaggactcgacctcggtcgacgag
ccggtaccggacttcagcgccaacctgaacgcctcgctgcaaggcctgcgcatcggcctg
ccgaaggaatacttcggcgccggcctcgacccgcgcatcgccgacctggttcaggccagc
gtcaaggagctggaaaagctcggcgcggtggtcaaggaaatcagcctgccgaacatgcag
catgccatcccggcgtactacgtgatcgccccggcggaagcctcctccaacctgtcgcgc
ttcgacggcgtgcgcttcggtcatcgctgtgaagatccgaaagatctgaccgacctgtac
aaacgctcccgtggcgaaggcttcggcgcggaagtgcaacgccgcatcatggtcggcacc
tacgccctgtcggccggctactacgacgcctactacgtcaaggcgcaacagatccgccgc
ctgatcaagaacgacttcatggccgcgttcgccgacgtcgacgtgatcctcggcccgacc
acgccgaacccggcctggaaacttggcgccaagagcagcgatccggtcgccgcctacctc
gaagacgtctacaccatcaccgccaacctggccggcctgccgggcctgtcgatgccagcc
ggcttcgtcgacggcctgccggtgggcgtgcaactgctggccccgtacttccaggaaggc
cgcctgctcaacatcgcgcaccgttaccagcaagtcaccgactggcacacccgcgccccc
aacggcttctga

DBGET integrated database retrieval system