KEGG   Pseudomonas monteilii SB3101: X970_05475Help
Entry
X970_05475        CDS       T02973                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00220  Arginine biosynthesis
pmot00250  Alanine, aspartate and glutamate metabolism
pmot00290  Valine, leucine and isoleucine biosynthesis
pmot01100  Metabolic pathways
pmot01110  Biosynthesis of secondary metabolites
pmot01130  Biosynthesis of antibiotics
pmot01210  2-Oxocarboxylic acid metabolism
pmot01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmot00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    X970_05475
   00290 Valine, leucine and isoleucine biosynthesis
    X970_05475
   00220 Arginine biosynthesis
    X970_05475
Enzymes [BR:pmot01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     X970_05475
    2.6.1.66  valine---pyruvate transaminase
     X970_05475
Amino acid related enzymes [BR:pmot01007]
 Aminotransferase (transaminase)
  Class I
   X970_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: AHC86888
UniProt: V9UXU3
LinkDB All DBs
Position
complement(1165735..1166946)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKQIEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSKELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHAQSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLKGYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgtttggcttcgaggcgcctgacgaaatcctccaggatgtgatccgcaac
ctgcccaccgcgcagggctacagcgactccaaaggcctgttcagcgcgcgcaaggcggtg
atgcagtactgccagcagaagcagatcgaaggcgtcggcatcgaggacatctacctgggt
aatggtgtgtccgagctgattgtgatgtcgatgcaggcgctgctcaacaacggcgatgaa
gtgctgatccctgcccccgactacccgctgtggaccgccgccgtgagcctggccggcggc
aagccggtgcactacctgtgcgacgagcaggccgactggttcccagaccttgaggacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggcgcggtgtactccaaagagctgctgctgggcatgctggaactggcccgccagcacaac
ctggtggtgttctccgacgagatctacgacaagatcctgtacgacgaagccgtgcacatc
agcaccgcctcgctggcccccgacctgctgtgcctgaccttcaacggcctgtccaagtcg
taccgggtggcgggcttccgttccggctggctgatcatctccgggcccaagcaccacgcg
caaagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcgctgggcggctaccagagcatcaacgacctggtgctg
ccgcccggccgcctgctggagcagcgcaaccgcacctacgagttgctgaacgacatcccg
ggcgttagctgcgtgaagccgatgggtgcgctgtatgcattcccgaagatcgacccgaag
gtttgcccgatccacaacgacgagaagttcgtgctcgacctgctgctgtcggaaaagctg
ctgatcgttcaaggtacggcgttcaactggccgtggccggaccacttccgcgttgtcact
ttgccgcgggtggatgacctggaggcggcgattggccggatcgggaatttcctgaagggt
tattcgcagtaa

DBGET integrated database retrieval system