KEGG   Pseudomonas monteilii SB3101: X970_06325
Entry
X970_06325        CDS       T02973                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pmot  Pseudomonas monteilii SB3101
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pmot03009]
    X970_06325 (rlmL)
Enzymes [BR:pmot01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     X970_06325 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     X970_06325 (rlmL)
Ribosome biogenesis [BR:pmot03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    X970_06325 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_15 Methyltransf_11
Other DBs
NCBI-ProteinID: AHC87035
UniProt: V9UZL3
LinkDB
Position
1345843..1348035
AA seq 730 aa
MSDRFELYLTCPKGLEGLLAEEARGLGLDDVREHTSAIRGAADMETAYRLCLWSRLANRV
LLVLKRFSMKNADDLYDGVHAVDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKIDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRAGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFSAWLGHVP
ALWRKVHDEAQARAQAGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVST
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVFTGAPQLGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGERREAQPEGAETRQQAAPASEPARLS
EGAQMFANRLQKNLKQLGKWARREQVDCYRLYDADMPEYALAVDLYQDWVHVQEYAAPRS
VDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGTRQYERQASEGRFQEVNEGGVK
LLVNLTDYLDTGLFLDHRPMRMRIQREAAGKRFLNLFCYTATATVHAAKGGARSTTSVDL
SKTYLDWARRNLALNGFSERNRLEQGDVMAWLEGNRDSYDLIFIDPPTFSNSKRMEGVFD
VQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLMARYAVEEITAQTLDPDFARNNR
IHRAWRLQLR
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactttacctcacttgccctaaaggcctggaaggcctgcttgcc
gaagaggcgcggggcctcggcctggatgacgtgcgcgagcacacctcggccattcgcggc
gccgccgacatggaaaccgcctaccgcctgtgcctttggtcacgcctggccaaccgggtg
ctgctggtactcaagcgcttctccatgaagaacgccgacgacctctacgacggcgtgcac
gcggtcgactgggccgatcacttggcagccgacggcaccctggcagttgagttcagcggc
catggctcgggcatcgacaacacccacttcggtgcgttgaaggtcaaggacgcgatcgtc
gacaagctgcgcaaccgtgaaggcctgcgcccgtcggtggaaaagatcgaccctgatgtg
cgcgtgcacctgcgcctggaccgtggcgaagccattctctcgctcgacctttccgggcac
agcctgcaccagcgtggctaccgcctgcagcaaggcgccgcgccgctgaaggaaaacctg
gcggcggcggtactcatccgcgccggctggccgcgcattgccgccgaaggtggcgcgctg
gccgacccgatgtgcggtgtgggtaccttcctggtcgaagcggcgatgatcgccgccgat
atcgcgcccaacctcaagcgtgagcgctggggcttcagtgcctggctcggccacgtaccg
gcattgtggcgcaaggtgcatgacgaggcgcaggcgcgggcacaggccggcctggccaag
ccaccactgtggatccgtggttacgaggccgacccgcggttgatccagccaggccgcaac
aacgtcgagcgtgccggcctgggcgactgggtgaagatctaccagggcgaagtcagcacc
ttcgaaccgcgcccggaccagaaccagaagggcctggtcatcagcaacccaccctatggc
gagcgcctgggtgacgaagccagcctgctgtacctctaccagaacctcggtgagcgcctg
cgccaggcctgcatgggctgggaggcggcggtgttcaccggcgcgccgcagctgggcaag
cgcatgggtattcgcagccacaagcagtacgcgttctggaacggcgccttgccgtgcaag
ctgctgctgttcaaggtgcagcccgaccagttcgttaccggcgagcgccgcgaggcgcag
cctgaaggcgcggaaacccgccagcaggcagcaccggccagcgagccggcgcgcctgtcg
gaaggggcgcagatgttcgccaaccgcctgcagaaaaacctcaagcaactgggcaagtgg
gcccgccgcgagcaggtcgattgctaccgcctgtacgatgccgacatgcccgaatatgcc
ctggcggtcgacttgtaccaggattgggtgcacgtgcaggaatacgccgcgccacgttcg
gtcgacccggacaaggcccaggcacggctgctcgatgcgctggccgccatcccgcaggcc
ctgggcatttcgccgcagcgtgtggtgctcaagcgtcgcgagcggcagagcggcacgcgc
cagtacgagcgccaggcgagcgaaggccgcttccaggaagtgaacgaaggcggcgtaaag
ctgctggtcaaccttaccgactacctcgacacgggcctgttcctggaccatcgcccgatg
cgcatgcgcatccagcgcgaagcagccggcaaacgcttcctcaacctgttctgctacacc
gctacggccaccgtgcacgcggccaagggcggcgcgcgcagcaccaccagcgtcgacctg
tcgaaaacctacctggactgggcgcgacgcaacctggcgctcaatggcttctccgagcgc
aaccgcctggagcaaggcgatgtgatggcctggctggaaggcaaccgcgacagctatgac
ctgatcttcatcgacccgccgaccttctccaactccaagcgcatggaaggcgtgttcgat
gtgcagcgtgaccacgtgcaactgctggacctggccatggcccgcctggcgccgggtggc
gtgctgtatttctccaacaacttccgcaagttccagttggacgagcaccttatggcgcgt
tatgcggtggaggagatcacggcccagaccctggacccggacttcgcgcgcaataaccgt
atccatcgcgcctggcgtctgcagcttcgttga

DBGET integrated database retrieval system