KEGG   Pseudomonas monteilii SB3101: X970_12565Help
Entry
X970_12565        CDS       T02973                                 

Definition
(GenBank) acyl-CoA dehydrogenase
Organism
pmot  Pseudomonas monteilii SB3101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-ProteinID: AHC88179
UniProt: V9UYB7
LinkDB All DBs
Position
2624672..2625715
Genome map
AA seq 347 aa AA seqDB search
MSIVQDFDLTNLDRLLRAFGERQQPLNLDTQLPQLIQALQADHLDLLPLPGQGNTLRRWQ
TLARVAGCDLALAKLYEGHTDALAILAECAAAHHAAEGIWGVWAAEPPDARACIVARDGD
QVRLEGRKAWCSGALQIDRALVTAWDQHDQPQLVAIELSHPSQGLVIDRWQAIGMATTAS
VEVEFNHTPGIAIGRPGQYLSRPGFWHGGAGIAACWYGAAEALADYLREHCRNPRPDPHA
DAHLGAVDAALYGARAALRECAAWIDRQPGADASFEVRRTRAQVEQAVEQVIHHVGRALG
ATPFCRDNHFARLSADLPVFLRQSHAERDLAALGEQLAKQPAGVWQL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgtccaggattttgacctgaccaacctcgatcgcctgttgcgagccttcggc
gagcggcagcaaccgctcaacctcgatacccagttgccgcagctgattcaggcactgcaa
gccgaccacctcgacctgctgcccctgcccggccagggcaatacgctacggcgctggcaa
accctcgcccgggtggcaggctgtgacctggccttggccaagctgtacgagggccacacc
gacgcgttggcgatccttgccgaatgcgcggctgcacaccacgctgccgagggtatatgg
ggcgtgtgggccgccgaaccgccggatgcccgcgcctgcattgtcgcccgtgatggcgac
caggtccgcctggagggtcgcaaggcctggtgttcgggcgcactgcagatcgaccgggcg
ctggtcacggcctgggaccagcatgaccaaccccagctggtggccatcgaactgtcccat
cccagccagggccttgtcatagaccgctggcaggccattggcatggccaccaccgccagt
gtcgaagtcgagttcaaccacacccctggcatcgccatcggccgccccgggcaatacctg
tcacgccccggcttctggcatggcggtgctggcattgcagcctgctggtacggcgccgcc
gaggcgttggccgattacctgcgcgaacactgccgcaacccccgccccgacccacatgcc
gacgctcacctgggcgcagtcgacgccgccttgtacggcgccagggcggcactgcgcgaa
tgcgcggcatggatcgaccgccagccaggcgcagacgccagcttcgaagtgcgccgcacc
cgcgcccaggtggaacaggccgttgaacaggtgattcaccacgttggccgggcgctgggc
gccactcctttctgccgtgacaaccactttgcccggctgagtgccgacttgccggtgttc
ctgcgccagagccatgccgagcgcgacctggcggcgctcggggagcaattggcaaaacag
ccggcgggagtctggcaactatga

DBGET integrated database retrieval system