KEGG   Pasteurella multocida 36950: Pmu_03700
Entry
Pmu_03700         CDS       T01729                                 

Definition
(GenBank) S-adenosyl-L-dependent RNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pmp  Pasteurella multocida 36950
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pmp03009]
    Pmu_03700
Enzymes [BR:pmp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     Pmu_03700
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     Pmu_03700
Ribosome biogenesis [BR:pmp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Pmu_03700
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Methyltransf_31 Cons_hypoth95 Methyltransf_25 MTS Methyltransf_11 Methyltransf_15 N6_Mtase Methyltransf_3 Methyltransf_24
Other DBs
NCBI-ProteinID: AET15297
LinkDB
Position
363853..366012
AA seq 719 aa
MKQLFATTARGFEELLKVELTDLGAMDCQITQGGVHFHADEETQYRVLLWTRLASRILLP
IVTCKVYSDLDLYSAVVGQNWLDYFDEKAHFMVDFNGTNREIRHTQFGAMRVKDGIVDYF
ERVGKPRPNVDKSQPDIRIHAYLNREELVISLDLSGDALHMRGYREDTGKAPLRETLAAA
IVLRSGWQLGTPLVDPMCGSGTLLIEAAQMQANIAPQLHRLHWGFDFWKGHNQQAWDKVK
GEAIELAEQTFNQNQKANFYGCDLDHRVLQKAKRNAQNAGVAHLIQWRQGDVAALKNPFV
EAKGTVICNPPYGERLGTTPALIALYSVFGQRLKQQFADWNVSIFSGEPALLDCLRLRSH
RQFKAKNGPLDCVQKNYHISARATASDENTQNLPEIDRTLSATQVAVDFANRLQKNSKKI
EKWARQQGINAYRLYDADLPEYNLAVDRYDDHIVVQEYAAPKNIDENKARQRLLDAVTAT
LQVTGVETNKLILKVRQKQKGTNQYEKLANKGDYFYVNEYGAKLWVNLTDYLDTGLFLDH
RLTRKMLGKMAKGKDVLNLFAYTGSATVHMALGGAKSTTTVDMSNTYLNWAEQNLLLNDL
EGKQHKLIQADCLQWLARCDRQFDLIFVDPPTFSNSKRMEDSWDVQRDHIKLMTQLKRIL
RPNGTIVFSNNKRGFKMDVEGLETLGLSAVDITAKTLPLDFERNKQIHNCWVVRLKADL
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaaacaactttttgccaccactgcccgtggttttgaagaattactgaaagtcgaacta
accgaccttggtgcgatggattgccaaatcacacaaggcggtgtgcactttcatgccgat
gaggaaacgcaatatcgcgtgttgttatggacacgtttagcctcgcggattttattaccc
attgtgacttgcaaagtgtatagcgatttagatttgtattctgcggtggtggggcaaaat
tggttggattattttgatgaaaaagcccattttatggtggattttaatggcacaaaccga
gaaattcgtcacacccaatttggtgccatgcgagtcaaagatgggattgtggattatttt
gagcgtgtaggtaaaccgcgtccaaatgtagataaatcacagcccgatattcgtattcat
gcctatttaaatcgcgaagaattagtgatctccttagatttaagtggtgatgccttacat
atgcgcggttatcgtgaagatacgggcaaagccccgttacgtgaaaccttagcggcagcg
atcgtcttacgttcaggctggcagctgggcacacccttagtggatccaatgtgcggttcg
ggtaccttgctgattgaagcagcacaaatgcaagccaacattgccccgcaattacaccgt
ctgcattggggctttgatttttggaaagggcacaatcaacaggcgtgggacaaagtgaaa
ggcgaggcgattgaattagcggagcaaacgtttaaccaaaatcaaaaagcgaatttttat
ggctgcgatcttgatcatcgagtactgcaaaaagccaaacgcaatgcccaaaatgcgggt
gtggcacatcttattcaatggcgacaaggcgatgtagcggcattaaaaaatccatttgtt
gaagcaaaaggcaccgtgatttgtaacccaccttatggagagcgtttaggcacgacacct
gctttaattgcgttatattccgtgtttggacaacgtttaaaacaacagtttgccgattgg
aatgtatcgattttcagtggcgagccggcgttattagactgcttgcgtttacgttcacat
cgccaatttaaagccaaaaatggtccactcgactgcgtgcaaaaaaattatcatattagt
gcccgtgcaacagcgagtgacgagaatacacaaaacttgccagaaattgaccgcacttta
agtgctactcaagtggcagtggattttgccaatcgcttacaaaaaaatagcaaaaaaatt
gaaaaatgggcgagacaacaaggcattaatgcctatcgcttatacgatgcggatttgcca
gaatataacttggcggtggatcgctatgatgatcatattgtggtacaagaatatgctgca
cccaaaaatatcgatgaaaacaaagcacgtcagcgcttattggatgcggtaaccgctacc
ttacaggtaacaggtgtagaaaccaacaaactgattttaaaagtgcgccaaaaacaaaaa
ggcaccaatcagtatgaaaaactcgccaacaaaggtgactatttctatgtcaatgaatat
ggcgccaaattgtgggtaaacctaacggattatttggatacgggacttttcctcgatcat
cgtttaacccgcaaaatgttggggaaaatggcgaaaggcaaagatgtcctaaatttattt
gcctatacgggatcggcgacggtacatatggcgttaggtggtgcaaaatcaaccactaca
gtggatatgtcaaacacctatttaaactgggcggaacaaaatctgttattaaatgacttg
gaaggtaaacagcataagttaatccaagcggattgcttacaatggttagcccgttgtgac
cgtcagtttgatctgatcttcgtcgatccaccgacattttctaattcaaaacggatggaa
gatagctgggatgtgcaacgtgatcacattaagttaatgacccagttaaaacgcatttta
cgtccaaatggcaccatcgtgttttccaacaacaaacgaggttttaaaatggacgttgaa
ggcttggaaacgcttggcttaagtgcggtagatattacagcaaaaaccttgccattggat
tttgaacgcaataagcaaattcataattgttgggtggtgaggttgaaagccgatctgtaa

DBGET integrated database retrieval system