KEGG   Paenibacillus mucilaginosus 3016: PM3016_1601Help
Entry
PM3016_1601       CDS       T01757                                 

Definition
(GenBank) Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00020  Citrate cycle (TCA cycle)
pmq00480  Glutathione metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
pmq01210  2-Oxocarboxylic acid metabolism
pmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PM3016_1601
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PM3016_1601
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PM3016_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFC28521
UniProt: H6N9Z3
LinkDB All DBs
Position
1807625..1808920
Genome map
AA seq 431 aa AA seqDB search
MAQFEQYALPTEGERITITNGVLNVPNNPIIPFIEGDGTGPDIWAASKRVLDAAVEKAYN
GEKKIAWYEVFAGEKAFNKYNNWLPADTLTAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCSRPVRYFKGVPSPVKRPELVDMVIFRENTEDIYAGIEWAAGSEEVKKVLAFLQ
NEMGVKKIRFPETSGIGVKPVSSEGSKRLVRAAIEYAIKHNRKTVTLVHKGNIMKFTEGA
FKNWGYELAEEEFGDKTFTWAQYDRIKEESGADAANAAQKAAEAEGKIIVKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
AGLDVVNPGSVILSGVMMLEHLGWLEAAELIYKGMETAINNKTVTYDFARLMEGATEVKC
SAFADQIIANF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattcgaacaatatgctctgccgactgagggcgagcgcatcacaattacgaac
ggcgtactgaacgtaccgaacaacccgatcattcctttcatcgaaggcgacggcacaggc
ccggacatctgggcggcttccaagcgtgtgctggatgcagcggtagagaaagcatataac
ggagagaagaaaatcgcttggtacgaagtgttcgccggcgagaaagccttcaacaagtac
aacaactggctgcctgctgatacgctgacagcgatccgtgaatacatcgtagcgatcaaa
gggcctctgacgacgccaatcggcggcgggatccgctccctgaacgttgcgctccgtcaa
gagctggacctgtatgtctgctcccgtccggtccgctacttcaaaggcgtaccttcccct
gtaaagcgtcctgagctcgttgacatggtcatcttccgtgagaacaccgaagacatctat
gccggcatcgagtgggctgcaggctccgaagaagtcaagaaagtgctcgcgttcctccag
aacgaaatgggcgttaagaaaatccgcttcccagagacttccggtatcggcgtgaagccg
gtgtcctccgaaggttcgaagcgtctggttcgcgcggcgatcgaatatgcgatcaagcac
aaccgcaaaacggttactctcgtacacaaaggcaacatcatgaagttcaccgagggcgcg
ttcaagaactggggctacgagctggctgaagaggagttcggcgacaaaaccttcacttgg
gctcaatacgaccgcatcaaagaagagtcgggtgcagatgcagcgaacgcagctcaaaaa
gcagcggaagctgaaggcaaaatcatcgtaaaagatgcgattgccgacatcgcgctgcag
caggttctgactcgtccgaccgacttcgacgtcatcgcgacgctgaacctgaacggcgac
tacctgtccgacgctctggctgctcaagtaggcggcatcggtatcgctcctggcgcaaac
atcaactatgtaacgggccacgcgatcttcgaagctacacacggtacggctcctaagtac
gcaggtctggacgttgtgaacccaggttccgtcatcctctccggcgttatgatgctcgag
cacctgggctggctggaagcggctgagctgatctacaaaggcatggaaacggcgatcaac
aacaagaccgttacttatgactttgctcgtctgatggaaggcgcaaccgaagtgaagtgc
tccgcgttcgctgatcagattattgctaacttttaa

DBGET integrated database retrieval system