KEGG   Paenibacillus mucilaginosus 3016: PM3016_176Help
Entry
PM3016_176        CDS       T01757                                 

Definition
(GenBank) histidyl-tRNA synthetase 2
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00340  Histidine metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01230  Biosynthesis of amino acids
Module
pmq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PM3016_176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AFC27157
UniProt: H6NTL0
LinkDB All DBs
Position
193251..194429
Genome map
AA seq 392 aa AA seqDB search
MSKPKVFEKPTGVKDYLPEAAAKLRSIELNVMQCMERWGYREIITPTLEYYDTVGVASST
EDKKLFKLLDRNGTTLVLRSDMTAPIARVVSSLLQNEAFPLRLSYQANVFRAFEAEAGRD
AEFFQTGVELVGDASSESDAEVIALAIACLQAAGVKQFKIAVGHVGFLNGLLQETLKHDA
EAQTLLKGCLLNRDYVGYREALQELQLTERVRGELEGILRLRGGQEICRQARELTEDPVA
QHAIAHLCEVWDVLQAYGVSDHVLIDLTMIGDFSYYTGMTFEGYAADLGFPVCSGGRYDN
LLKQFGRPAPATGFALKTNRILEVVGRETLGRRLRKTLVLYTAGRRADALARAAELRTEE
GRTVETRLIPEGFFVAVQGLPYDDVLEFVGEG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaaaccgaaggtgtttgagaagcctacaggcgtgaaggactatctccctgaggca
gctgccaaactgcgcagcattgagctgaacgtgatgcagtgcatggaacgttgggggtat
cgtgagattatcacgccaacgctggaatattacgatacggtgggagtggccagttctacg
gaagacaagaagctgttcaagctgctcgaccgcaacggaacgacactggtgctgcgttcc
gacatgacggcaccgatcgcaagggtcgtttcgtctcttctgcagaatgaggccttccct
ctgcgactctcctatcaggcgaatgtgttccgggccttcgaggcggaagccggccgggat
gcggaattcttccaaaccggcgtggagcttgtcggtgacgcttcgtccgaatcggatgcc
gaagtgattgcgctcgccattgcgtgtctgcaggcggcaggcgttaagcagttcaagatt
gccgtgggtcacgtcggcttcctgaacgggctgctgcaggaaacgctgaagcatgacgcg
gaggcacagacgctgctgaagggatgcctgctgaaccgcgattatgtaggctatcgggag
gcgcttcaagagctgcagctgaccgagagggtacggggcgagctggaggggattctgcgg
ctgcgcggcggccaggaaatctgccggcaggcgcgcgagctgaccgaggacccggtagcc
cagcatgcgatcgcccacctttgcgaggtatgggatgtgctgcaggcttatggtgtcagc
gatcatgtgctcatcgacctgacgatgatcggagacttttcttattatacggggatgacg
ttcgaaggttatgccgccgatctcggcttcccggtatgcagcggcggacgttacgataac
ctgctgaagcagttcggccgtccagctccggcaaccggattcgctctgaagaccaaccgg
attcttgaagtcgtcggacgggagacgctgggacgccggctccggaagacccttgtgctt
tatacggcgggacggcgggcagatgcactggcccgtgcagcggagctgagaacggaagaa
ggacgtacggtggagacccggctgattccggaaggatttttcgtggcggtccaggggctg
ccgtatgacgatgtgcttgaattcgtaggcgaaggatag

DBGET integrated database retrieval system