KEGG   Paenibacillus mucilaginosus 3016: PM3016_179Help
Entry
PM3016_179        CDS       T01757                                 

Definition
(GenBank) HisB
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00340  Histidine metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01230  Biosynthesis of amino acids
Module
pmq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PM3016_179
Enzymes [BR:pmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     PM3016_179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD Lipoxygenase
Motif
Other DBs
NCBI-ProteinID: AFC27160
UniProt: H6NTL3
LinkDB All DBs
Position
196525..197136
Genome map
AA seq 203 aa AA seqDB search
MANEQDQQAVRRSEVARKTNETDIRLAFAVDGSGVSEIETDVPFLNHMLDLFTKHGQFDL
RVDAKGDVEIDDHHTVEDIGICLGQTLREALGDKRGIKRYASVFVPMDEALAQVVIDVSN
RPHFEYRAQYPSQTVGSFQVELVHEFLWKLALEARITLHVIVHYGLNTHHMIEAVFKALG
RALDEATSIDPRVQGVPSTKGVL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgaacaagatcagcaagcagtccgccgctccgaagtggcgcgcaaaaccaat
gagaccgatatccgtctggccttcgcggtagacggaagcggcgtatcggagatcgagacg
gatgtgcctttcctcaatcatatgctggacctgttcacgaagcacggccagttcgatctg
cgtgtggatgccaagggcgacgtggagattgacgatcaccacaccgtggaagatatcggg
atttgcctcgggcagacgctccgtgaagcgctcggcgacaagcggggcatcaagcgctat
gcgagtgtgttcgtccctatggacgaggcgctggcgcaggtggtcatcgacgtgagcaac
cggccgcacttcgaataccgggcgcagtatccgtcccagacggtgggcagcttccaggtg
gagctcgtgcacgaattcctgtggaagctggcactggaggctcgtattacgcttcacgtt
atcgtccactacggactgaacacacaccacatgatcgaagcggtcttcaaagcgctgggc
cgggccctcgatgaggcgacaagcatcgatccgcgcgtacagggcgtgccttcgacgaaa
ggggtcctgtaa

DBGET integrated database retrieval system