KEGG   Paenibacillus mucilaginosus 3016: PM3016_2374Help
Entry
PM3016_2374       CDS       T01757                                 

Definition
(GenBank) GutB2
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00040  Pentose and glucuronate interconversions
pmq00051  Fructose and mannose metabolism
pmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PM3016_2374
   00051 Fructose and mannose metabolism
    PM3016_2374
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     PM3016_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AFC29262
UniProt: H6NKV6
LinkDB All DBs
Position
2745038..2746123
Genome map
AA seq 361 aa AA seqDB search
MKMAEHELPKTMKAAVMHRTRSIVIEEVPLPEIGPHEVLVKVMAVGICGSDLHYYSHGRI
GPYVMEGPFILGHECAGDVAAVGSAVSRFAAGDRVAVEPGVTCGRCEACKAGRYNLCPGV
EFLATPPYDGAFVQYIKIREDFLFPIPDSLSYEEAALVEPFSVGIHAAARTGLQPGSTIA
IMGMGPVGLMAVAAAKAYGAAQIIVTDLEPLRLDAAKRLGATHAVNIREQDPLQAVKEIT
GGRGVDVAWETAGNPKALQSALGSLRRGGKLAIVGLPAQDEIPLNVPFIADNEVDIYGIF
RYANTYPKGIRFLSSGIVDAKSLITDRFALEQTQEAMERALNHKSECLKVIVYPNGLLQG
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggcagagcatgaacttccgaagacaatgaaggcggcggtcatgcaccgcacg
cggtcgatcgtgatcgaagaggtgccccttccggagatcggaccgcacgaggtgctggtc
aaagtcatggccgtcggcatttgcggctccgatctgcactattattcgcacggccggatc
ggcccgtatgtcatggaggggcccttcatcctcgggcatgaatgcgccggcgacgttgcg
gcggtggggtctgcggtcagccggtttgcggctggggaccgggtggccgtcgagccgggc
gtcacctgcggacgctgcgaagcctgcaaggcgggccgctacaacctgtgtccgggcgtc
gaattcctggcgacgcctccttatgacggggctttcgtgcagtatatcaaaatccgcgag
gacttcctcttcccgatcccggacagcctctcttacgaagaggccgcactggtggagccg
ttctcggtcggcatccatgcggcggcccgtacggggctccagccgggctcgaccatcgcg
atcatgggcatggggccggtcggtctcatggctgtggcggcggccaaagcttacggggcg
gcgcagattatcgtgaccgacctggagccgctgcgcctggacgcggcgaagcggctcggc
gccacccatgccgtcaacatccgcgagcaggatccgctccaagcggtcaaggagatcacg
ggcggccggggcgtcgatgtcgcctgggagacggccggcaacccgaaggcgctgcagtcc
gcgctggggtcgctccgccggggcgggaagctcgccattgtcggactccccgcgcaggat
gagatcccgctcaacgtgccgtttattgcggacaacgaagtcgatatctacgggatcttc
cgctatgcgaatacgtacccgaaggggatccgcttcttgtcttcgggcatcgtcgatgcg
aagagcctgatcacggaccgcttcgcgctggagcagacgcaggaagcgatggaacgggcg
ctgaaccacaagagcgagtgcctgaaggtgatcgtgtatccgaacggtctgctgcagggc
gaatga

DBGET integrated database retrieval system