KEGG   Paenibacillus mucilaginosus 3016: PM3016_4073Help
Entry
PM3016_4073       CDS       T01757                                 

Definition
(GenBank) YybE
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 HTH_5 MarR_2 HTH_24
Motif
Other DBs
NCBI-ProteinID: AFC30855
UniProt: H6NK02
LinkDB All DBs
Position
4806348..4807238
Genome map
AA seq 296 aa AA seqDB search
MEWQQLEYFQTLARMQHVTRAAEALSLSQPALSRSIARLEEELGVPLFDRQGRTIVLNRY
GRLFLNRTDRILAEYKLAKQELSDLIDPDSGEVALGFLHTLSTGIIPDLIGGFRAGFPAV
RFQLIQNHSYSLLEHLHAGELDICLISQPSETRFPIRWTPLWSEEILVVLPLGHPLAGAG
SIQLQEIADEPFIFLKKGYALRELTDRLFEQAGIHPRITFEGEESATAAGLVAAGLGISL
LPRAGLDHSGVACVRLAGPPCERTVGFAELEGRFLPPAAERFKAYVLGYFGRLGSP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcagcagctcgaatactttcagaccctcgcccggatgcagcatgtgacgcgg
gcggccgaggccttgtccctctcccagccggccctcagccgttcgatcgcccgcctggag
gaggagctgggcgtcccgctctttgaccgccagggccgcacgattgtcctgaaccgttac
ggacggctgttcctgaaccggaccgaccgtattctggccgaatacaagctcgccaagcag
gagctctccgatctcatcgatccggactccggtgaagtcgcgctcggcttcctgcatacg
ctgagcaccggtatcatccccgatctgatcggcggcttccgggccgggttcccggccgtc
cgctttcagctcatccagaatcacagctattccctgctcgagcatctgcatgccggtgag
ctggatatttgcctgatttcccagccgtcggagacccgctttccgatccgctggactccg
ctgtggagcgaggagatcctcgttgtgctcccgctggggcatccgctggccggagccggg
agcatccaactgcaggagatcgcggatgaaccgttcattttcttgaagaaggggtatgcc
ctgagggaattgaccgacagattattcgagcaggcgggcatccatccgcggattacgttc
gagggcgaagaaagcgccacggcagccggactcgtcgccgcggggcttggcatttcgctg
ctcccccgtgcaggactggaccacagcggagtggcctgcgtccggcttgccgggccgcca
tgcgaacggacggtcggcttcgccgagctggaggggcggtttctgccgcccgcggccgag
cgcttcaaggcgtatgtactgggctattttggcagactgggatcgccctga

DBGET integrated database retrieval system