KEGG   Paenibacillus mucilaginosus 3016: PM3016_4581Help
Entry
PM3016_4581       CDS       T01757                                 

Definition
(GenBank) beta-lactamase
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFC31329
UniProt: H6NDI9
LinkDB All DBs
Position
complement(5526387..5531777)
Genome map
AA seq 1796 aa AA seqDB search
MIEILPEVNSLVDLLRCRAERQSDATAFSFLTEDGKENVLTYGDLDRRARTLAVWLARRD
AGGKRALLLYPPGLDYIAAFFGCLYAGTAAVPAYPPRLNANLRRMQSIVSDCRADFALTD
APTLAQLQLKFPDSPLLTELQWGVTDSWSEEDPGSWSAPAVGAQGTRLAFLQYTSGSTSA
PKGVMLTHDNLLHNLGLIQRSFGLTPESRSVIWLPPYHDMGLIGGILQPLYTGFPVTLMS
PAHFVQSPLKWLETISRTGASVSGGPNFAYELCVRRIDREELQALDLSRWTCAFTGSEPI
QAETLKRFAEVFEPCGFRYESFYPCYGLAESTLFVTGAQRGTGPVVRSFEGKMLEENRVV
TADADSADGRSLVSSGCTLESDPQVVIVDPLTGERCGEDRVGEVWITGRSVAQGYWNREE
QTAETFGGQLAGGGGGPFLRTGDLGFLSSGELFVTGRWKDLIIIRGRNYYPQDIEFCVSE
SHPAVRSGNGAAFSVTLDGEERLVIVHELERAYRKSDPMPVFESIVGAVAERCGLQVHAI
ALIRPASIHKTSSGKIQRSACRQAYLEGTLEILAKYREDGEYAGAEAPGEKEEADGSRKE
RPGLPDRAELLKLPDEERRRELVHYLCTETARMVKGPSRCGPESTLQTLGFDSLKIVEWK
ARIEEVLEVDIPFDTLLDGPSLSDTAAVIDRLLLSSESQGEKKRLQAEPASQAEFPLSAG
QRALWFLQKLNPAGRAYIISRTLHIRSGLRPELFVRAIDALHQRHPLLRSRVVERDGEPV
LIPDKAVRDCITYTDTAGWPEVQLLERIREASELPVDLEQGPLFRVHLYGCGEGEAYLLI
TLHHIIGDFWSFAVFAKEFGEVYSALTEDRNWTPAEPGSYRTYVERQSEAPAGEAESGLA
FWQSRLQGAEPVQLQHALPAPAPDEPRGRKVGFTLSSALSRRLAALARESGCSQYSTLLS
AFTCLLHRYTGQSDLTVGTPTSGRLNRHDAGTFGYFVNPLVIRTASVPRETVREMIGRVH
QGVTEALKHQTYPFPLLVERLQPHRGGRQPLFNVMFSMHVPVLEQDDGLVAAALGLPGAA
VSLGPLTAELSEPAVQEAQFDLTLTMGRVGEVLHGTLEYDPARFTEEGMRRLAAHLTVLL
EGMAQNPDERAARLPLLTREEEARQAREWNSTNIPYPGTGLQERFESWAEQAPERTAVVY
QEQTVTYGELNRMANRLAHRLQSLGVGPDTLVGVCLDRSPELAAGLLAVLKSGGAYVPLD
PSLPAQRLAYMTERAGLKALVTKRAWAEGFTERAGLTVICMDEEKPVTGLYPETNPQNDA
GAEHLMYVIYTSGSTGTPKGASVYRRGFENLMQWYTGEFGMSEEDRILLISSPSFDLTQK
NIFAPLVTGGQLVLLPSGPYDAREVSGLICRHGITLLNGTPSAFYPLLQETEAQGYAGLS
TLRHVFLGGEAIAADKLAAWTQSPSCRAQVVNTYGPTECTDVTVFSRLTDMKPLAGKPVP
IGRPVPNTRLYILNSELGMVPAGAPGELCIAGVQVGGGYLGDPGLTAEQFTANPYGDEAA
PVLYRTGDLARYLPDGTVEYLGRMDHQVKIRGYRIEPGEIEAALRECGGVSDAFVMARED
RPGEHQLAAYIVGGGVPGKGQDAADFVQQWRMDLRRKLPDYMVPSAFVLLDRLPLSPNGK
VDRKALPVPEGGGIREQPYTPPRTRTESALAGVWAEVLGLEKVGIHDNFFELGGHSLLAT
QVISRIRTSLQADLPVHRLFDTPTIAELAAALEEESTPKPSKPRMTRLSRSEHRVQ
NT seq 5391 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatcctgccggaagtaaactcccttgtggatttactgcgctgccgtgctgag
cggcagagtgatgcgacggctttttcctttctaaccgaggacggaaaagagaacgtactg
acctatggcgatcttgaccggagagcgaggactctcgcggtatggctggcccgcagggat
gcggggggcaagcgagccctgctcttgtatccgcccggattggattatattgcagctttc
ttcgggtgtctgtatgccggaaccgctgcggtgcctgcgtacccgccccgcctgaatgcc
aacctgaggagaatgcagtccattgtatcggactgccgggccgattttgctctcacggat
gcccccacacttgcgcagcttcagctcaaatttcccgattctccattacttaccgagctt
caatggggagtcaccgattcgtggtcggaggaagatcccgggagctggagtgcgcctgct
gtgggagcacagggcacccgtcttgcctttttgcagtacacgtcgggttctacgtctgcc
cccaagggggtcatgctgacccatgataatctcctgcacaacctggggctgatccagcgc
tccttcggtcttacgccggagagccgtagcgtcatctggctgcctccttatcatgatatg
gggctgatcgggggaatactccagccgctgtataccggatttccggtgaccttgatgtcc
ccggcccattttgtccagagtccgctgaagtggctcgagaccatctcccggacaggagca
tccgtaagcggggggcctaacttcgcatatgagctgtgtgtccgcaggattgatcgggag
gagcttcaagccttggatctcagccggtggacctgtgcattcacaggctccgaaccgatt
caggcggagaccctgaagcggtttgccgaggtgttcgaaccgtgcggattccgttacgaa
tcattttacccctgttatggtcttgcggagagtacgctttttgtcaccggagcgcagcgg
gggactggccccgtggtgcgcagctttgaagggaagatgctggaggagaaccgggtggtg
acggcggacgcggactccgcggacggacgcagcctggtcagctccgggtgcacccttgag
agcgacccgcaggtggttattgtggatcccttaaccggagagcgctgcggtgaggaccgg
gtgggcgaagtctggatcaccggcagaagcgtcgcccaaggatattggaaccgggaggaa
caaacggcggagaccttcggcggccagctggccggtgggggtggaggcccattcctccgc
accggagatcttggattcctgtcttccggggagctctttgtaaccggaagatggaaggac
ctgatcattatccggggcaggaattactacccgcaagatatcgagttctgtgtatcggag
agtcatccggcggtccgctcagggaatggagcggccttctcggtcacgctggatggagaa
gaacggttggtgatcgtgcacgagctggagcgtgcctaccgcaagagcgaccccatgccg
gtattcgagtcgatcgtgggagcggtagcggagcggtgcggactgcaggttcatgccatt
gctttaatcaggccggcgtccatccataagacgtcgagcggtaaaatccagcgcagtgcc
tgccggcaggcctatctggaaggtacgctggagatcttggccaagtacagagaggacggg
gagtatgcgggagcggaggctcccggtgagaaggaagaggcggacggttcaaggaaagag
cggcccgggttaccggatcgtgccgagctgctgaaactgccggatgaggagagaaggagg
gaattggtacattatttgtgcacggaaacggcacgtatggtcaaaggtccgtcgcgctgc
ggtccggagagtacacttcagacgcttggcttcgattcgctgaagatcgtcgaatggaag
gcgcggatcgaagaggtactggaggtggacattccgttcgatacgctgctggatggaccg
agcctgtcggacactgcggcggtgattgaccggctgctgctgtcttcggagtctcaagga
gagaagaagaggctgcaggcagaaccggcttcacaggcggagtttcctctgtctgcgggc
cagcgggctctctggttcctgcagaagctgaacccggcaggccgggcctacatcatctcc
cggacgcttcacatccgcagcgggctgcggccggagctcttcgtccgcgctattgatgcg
ctgcaccagcgtcatccgctgctgcgcagccgggttgtcgaaagggacggcgaaccggtg
ctgatcccggacaaggcggtcagggactgcatcacctatacggatacggcgggctggcct
gaggtgcagcttctcgaacgcatccgggaggcttccgagcttcccgttgacttggagcag
ggccccctgttccgcgtacacctgtacggctgcggtgaaggcgaagcgtaccttctgatc
actcttcatcacatcataggagatttttggtcctttgccgtgtttgccaaggagttcggg
gaagtgtattcagcgctgaccgaagacaggaactggacgccggccgagcctggaagctac
cggacctatgtagagcggcagagtgaagcgccggcaggggaggcggagagcggcttggcg
ttctggcagagccgtctgcagggtgcggaacccgtgcagctgcagcatgcgctgcctgca
cccgcaccggatgaaccgcgaggacgcaaggtcgggttcaccctctcgtccgccctctcc
agacggctggcagccttggccagagaaagcggatgctcccagtacagcaccctcctcagc
gcattcacctgcctgcttcaccgttacacgggacaaagcgacttgacggtagggacgccg
acttcgggccggttgaaccgccatgatgcagggaccttcgggtatttcgtcaacccgttg
gtcatccgtacggcgtcggttccccgggaaacggtccgtgaaatgatcggacgggtgcac
caaggggtgacggaggcgctgaagcatcagacatatccgttcccgctgcttgtggaacgg
ctccagcctcaccggggcggccggcagcctctgttcaacgtgatgttctctatgcatgtc
cctgtgctggagcaggacgacggtctcgtggctgcggcacttgggctcccgggggctgcg
gtcagcctgggacctctcacggcggaactcagcgaaccggccgttcaggaagcgcagttc
gatctgaccctgacgatgggccgggtgggagaagtgctgcacggcacgctggaatacgat
ccggcccgctttactgaagagggcatgcggcggctggctgcccacctgaccgtgcttctg
gaaggcatggcacagaatccggacgaacgtgctgcaagacttccgctgctaacgcgtgaa
gaggaggctcggcaggcccgggaatggaattccacgaatatcccgtacccaggaacggga
ctccaggagcggtttgaatcatgggccgaacaggcaccggaacggaccgccgtcgtttat
caagagcaaaccgtaacgtacggcgaactgaaccggatggccaaccggctggcccaccgg
ctgcagtcgctgggcgtcggacccgatacgctggtcggcgtgtgtctcgaccgcagtccc
gagctggctgcaggcctgctggccgtgctgaagtccggcggagcttatgtaccgcttgac
ccgtcgcttccggcgcagcggcttgcttacatgacggagcgggcgggattgaaggcgctg
gtcacgaagcgggcatgggccgaaggcttcaccgaacgggccgggctcaccgtcatctgc
atggacgaggagaagccggtcaccggtctctaccccgaaacaaatccgcagaatgatgcg
ggagcggagcatctgatgtacgtcatctatacgtcgggctcgacggggacccccaagggg
gcaagcgtataccgccggggatttgagaatctcatgcagtggtacaccggggagttcggc
atgagtgaagaggaccggattctgctgatctcttcaccgagctttgatcttacccagaaa
aatatattcgctccgctggtgaccggcggacagctggtgcttctgccaagcggcccgtac
gatgcgcgggaagtatccgggctgatctgccggcacgggatcaccctgctgaacgggaca
cccagcgccttctacccgctgctgcaggagacggaggcgcaggggtatgcggggttaagc
acgctccggcacgtattcctgggcggggaagcgatcgccgccgacaagctggcggcctgg
acgcagtccccctcctgccgggcccaggtggtcaatacctacggacccacggaatgcacg
gatgtgacggtgttcagccgtctgacggatatgaagccgcttgccggcaagccggttccg
atcggacgtccggtgccgaatacacgactctatattttgaacagcgagctgggtatggtg
cctgcgggagcgccgggtgagctgtgtattgccggtgtgcaggtgggcgggggttacctg
ggcgatccgggattaacggcggaacaattcacagccaatccgtacggggatgaggcggca
ccggtgctgtaccggaccggtgacctcgcgaggtatctgccggacggcacggtcgaatac
ctgggccggatggatcatcaggtgaagatccggggataccggattgaaccgggggagatc
gaagcggctctgcgggagtgcggcggagtaagtgacgccttcgtcatggcaagggaggac
cgtcccggcgaacatcagcttgcagcctatattgtgggtggcggcgtaccgggcaagggg
caggatgccgcggacttcgtgcagcagtggcgcatggatctgcggcggaagctgccggac
tatatggttccttcggctttcgtcctgctcgaccggcttccgctgtcgccgaacggcaag
gtggaccgcaaggcactgccggtaccggagggcggcggtatacgggaacagccgtatacg
cccccgcgcacccgcaccgaatcggccttggcgggggtatgggcagaggtgctggggctg
gagaaggtcggcattcacgacaacttttttgagcttggcgggcattcgctcctggccacc
caggtgatctcccggatcaggacctccctgcaggcggatcttcccgtacaccggctgttc
gatacgccgacgattgccgaactggcggcggcgctggaggaagaatccacgccgaagccg
tccaagccaaggatgacccggctctcgcgcagcgagcaccgggtacaatag

DBGET integrated database retrieval system