KEGG   Paenibacillus mucilaginosus 3016: PM3016_485Help
Entry
PM3016_485        CDS       T01757                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PM3016_485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AFC27455
UniProt: H6NSN4
LinkDB All DBs
Position
complement(564643..565920)
Genome map
AA seq 425 aa AA seqDB search
MQYAYGALTPLRLLEETRFWKGQEREHTVVIRELAPALEPDYKRLLQEWEVVLARAETSA
GRWIEALLRRPAPASPALRQEVRRFLEASAVQSQAFVRQLHLLMERSRTIRTQPPLRAIL
LHLIRESEYFLGVLQAAAGGPGAYEEGLSGGSFAPDDAQTGQEGQGGSDGHPLSAHDTGG
DPSEAQPPEEPYDSSGATATQEGVWTMGIRPVPAYAKPVPIGGHRLPPLPYPYDALEPHI
DKETMRLHHTKHHLSYVEGLNKAELALARAREIGDYALVKHWERETAFHGAGHYLHTLFW
QVMKPGGGGPPTGTIAADLKKSFGGFSPFRKQFSAAAEKVEGGGWALLVWSPRSHRLEIL
QAEKHQNLSQWDVIPLLVLDVWEHAYYVRYRNDRARYIEAWWNTIHWEHVNERLEAARGL
KWPPF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttacggtgcgctcacgccgctcagactgctcgaggagacgcgcttctgg
aaagggcaggagcgtgagcatacggtcgtcatccgcgagctggcccccgcccttgaaccc
gactacaaaaggctgctgcaggaatgggaggtcgtgctggcccgggccgaaacctccgcc
gggcgctggatcgaggccttgctccgcaggccggctcccgcctccccggctctgcggcag
gaagtgcggcgcttcctggaggcctcggctgtccaatcgcaggccttcgtccggcagctc
cacctgctcatggagagaagccgaacgattcggacccagcctcccctccgcgcgatactc
cttcatctcatccgggagtcggagtacttcctcggtgtgctccaggccgccgcaggaggg
cctggagcatacgaggagggactctccgggggaagcttcgcaccagacgacgcgcagacc
ggacaagagggacagggaggatcggatgggcacccgctctctgcccacgacactgggggg
gatccgtctgaagcccagccgccggaagagccttatgacagctccggcgccacggcaacc
caggagggggtctggaccatgggcatccggcccgtcccggcttatgccaagccggttccc
atcggcggacatcggctccctccgcttccttatccgtacgatgctctcgaaccccatatc
gacaaagaaacgatgcgcctgcaccacaccaagcatcacttaagctatgtggagggcctc
aataaagcggagcttgccttggcccgcgcccgggagatcggcgattatgccctcgtgaag
cattgggagcgggaaaccgccttccacggagcggggcattacctccatacgctgttctgg
caggtgatgaagcccggagggggcggtccgcccaccggcaccattgcggcggaccttaag
aagtccttcggcggcttctcccctttccgcaagcagttcagcgcggccgccgagaaggtg
gaaggcggcggatgggcgcttctcgtctggagtccgcgcagccacaggctcgagatcctg
caggcggagaagcaccagaacttatcccagtgggacgtcatcccgctcctcgtactcgac
gtctgggagcatgcttactatgtccgctaccggaacgaccgtgcacgctacattgaagcc
tggtggaacactatacactgggagcacgtgaacgaacgcctggaagccgcacgcgggctc
aagtggcctcctttttga

DBGET integrated database retrieval system