KEGG   Paenibacillus mucilaginosus 3016: PM3016_5229Help
Entry
PM3016_5229       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: AFC31942
UniProt: H6NQU9
LinkDB All DBs
Position
complement(6250937..6251617)
Genome map
AA seq 226 aa AA seqDB search
MKLQQLTPHVWGGSVWLPVPVMIWFVKEEEGITLVDGGVLPMWEGVRKALQETFAGLPLR
RVLLTHGHQDHIGILPPLIEAYPEVPILVHSEEIPFLTGSRSYRSLREGVWARYAPPVPE
EKLTALRPEASYAGLQPYWTPGHSPGHTVFYHEADDILLAGDLFTRYFGRLQRPIAGFTA
DMDLSLRSGSILEKLKPKYTASAHLGVTRDAHLQYARLLPPLLAGR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcagcagctgaccccgcacgtatggggcggatccgtatggcttcccgtacct
gtgatgatctggttcgtgaaggaggaagaaggcattacgctcgtggacgggggggttttg
ccgatgtgggagggggtccggaaggcgctccaggagaccttcgccggcctgccgctgcgg
cgtgtgctgctgacgcacggccatcaggatcacatcggcattctgccgccgctcatagaa
gcgtaccccgaggttccgattctcgttcactccgaagagattccgttcctcacggggagc
cggtcctaccgttccctgagggagggggtgtgggcccgctatgctccgccggtgccggag
gagaagctgacggctctgcgcccggaggcgtcgtacgcggggctgcagccttattggacg
ccggggcacagtccggggcatacggtgttctatcacgaggcggatgacatccttttggcc
ggggatctgtttacccgctatttcggacggctccagcggcctattgccggatttacggcg
gatatggacctctcgctgcgcagcgggagcatcctcgaaaagctcaagccgaagtacacg
gcctccgcccacctgggcgttacgcgcgatgcccatctgcagtatgcccggcttcttccc
ccgcttctggccgggcggtaa

DBGET integrated database retrieval system