KEGG   Paenibacillus mucilaginosus 3016: PM3016_5241Help
Entry
PM3016_5241       CDS       T01757                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmq01001]
    PM3016_5241
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PM3016_5241
Protein kinases [BR:pmq01001]
 Serine/threonine kinases: Other
  Bacterial family
   PM3016_5241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo Haspin_kinase Seadorna_VP7 Pkinase_fungal PIP49_C Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AFC31954
UniProt: H6NQW1
LinkDB All DBs
Position
complement(6262217..6264421)
Genome map
AA seq 734 aa AA seqDB search
MIGRQLGGRYEILERVGGGGMAIVYKGLDILLHRHVAVKILRQQYVHDEEFIQRFRREAQ
AAASLSHPNVVSIYDVGQEDDVHYIVMEYIEGTTLNDRIKEKAPLQVEEAVHIAGQICDA
LDHAHHNQIIHRDIKPHNILIGKNGRVKVTDFGIARAVTSSTITQTGSVVGSVHYFSPEH
AKGTTTGEQSDLYSLGIVMYQMLTGRLPFLGESPISVALKHLQEDVEEPRKVNPLIPQSV
ENIILRAMRKSTAERYRSAKEMLGDLESCLQPHRRGEPKVSFFDDDDMDEERTRVMPAIR
PGQYEISAVEDDEPPKPAASENPPEKKKGGWVKPVMWLLVLAVMVGGMWYLVRYVQAVTT
APEDVMVPDLRGRPVAEARQTLESLGLGVDIEPQSSTEVPKETVILQDKANMKIRKDSRV
KLTVSTGPPPQKMPDLKKLKLADAKTKLLQLGIKAENIKTDDMVMDEEPGLVLTQTPAAN
AEFTDPAATQVTLGVSKGPETIPMPNLIGLSENEAKNKILVNKLKIAKDGVSYQPNYKLS
QGKVISQFPYQPDEVVAPGTEISLTVSSGLPKEAGQMAVNVPVRPAKEGAVSTVKIILTD
ASRESVEYQTLTGVDKLQTFQVNVVVSPEQNASIQIKADNTVIDVITVTYEDFKNHGKSG
KPFTPGTGTGAGTAEPGGAAGSTTAPSGTTGTGGNGTGTGGTGAAKPGTETPAAGTQEPA
GTSGNTTGTGGQNP
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtaggcagcttggaggacgttatgagattctcgagcgggtcggcggcggcgga
atggccatcgtttataagggactagatattttactacatcgccatgtcgccgtaaaaata
ctgcgccagcagtatgtgcatgatgaagaattcatccagagatttcgccgcgaagcacaa
gccgcagcctcattgtcgcatccgaacgtggtcagcatctacgacgtgggtcaggaagat
gacgtgcactacattgtcatggagtatatcgagggcacgacgctcaatgaccggatcaag
gaaaaggctccccttcaggtggaggaagccgtacatattgcgggacagatctgcgatgcg
ctggatcacgcccatcataatcagatcatccaccgcgacatcaagcctcataacattctc
atcggcaaaaacgggcgggtcaaagtcacggacttcgggatcgcccgcgccgtcacctcc
tcgacgatcacccagaccggctcggtggtgggatcggtgcattatttctcgcccgagcat
gccaagggcacgacgacgggagagcagtccgacctgtactcgcttggcatcgtcatgtat
cagatgctgacaggaaggctgcccttcctcggcgaaagcccgatctccgtggcgctgaag
cacctgcaggaggatgtggaggagccgcgcaaggtcaatccgctcatcccgcaaagtgtg
gagaacatcattctgcgcgcgatgcgcaagagcacggcggagcgctaccgttccgccaag
gagatgctcggcgacctggagtcctgcctgcagccccaccggcgcggggagcccaaggtc
agcttctttgacgacgatgacatggatgaggaacggacccgggtcatgccggccatccgt
cccgggcagtatgagatcagcgcggtggaggatgacgagccgccgaagccggccgcatcg
gagaaccctcccgaaaaaaagaaaggcggctgggtcaagcccgtcatgtggctcttggtc
ctggccgtcatggtcggcggcatgtggtatctggtccgctatgtgcaggccgttaccacg
gcgcctgaggacgtcatggtgcccgatctcaggggcaggccggtcgccgaggcgaggcag
acgctcgagagcctgggacttggagtggacatcgagccgcagagcagcaccgaggttccg
aaggagaccgtcatcctgcaggataaagcgaacatgaagatccgcaaggattccagggtc
aagctgacggtgagcaccgggccgcctccgcagaagatgccggatctgaagaagctgaag
ctcgcggacgcgaagacgaagctgctgcagctcggcatcaaggcggagaatatcaagacc
gatgatatggtcatggacgaggagcccggactggttctcacccaaacgccggcggcgaac
gcggaatttaccgatccggcggcaacgcaggtcactcttggtgtgagcaaggggccggag
acgatcccgatgccgaacctcatcggcctctccgagaacgaagccaagaacaagattctc
gtcaacaagctcaagatcgccaaggacggggtcagctaccagccgaactacaagctcagc
cagggcaaggtcatcagccagttcccttaccagccggatgaagtggtggcgccgggaacg
gagatttccctgaccgtctcgtccggtctgccgaaggaggcggggcagatggcggtcaac
gtgccggtccgtccggccaaggaaggagccgtgtccacggtcaagatcattttgacggac
gcctcccgggagagtgtcgagtaccagaccctgacgggggtggacaagctgcagacgttc
caggtcaatgtggtcgtctcgccggaacagaatgcgagtatccagatcaaggcggataac
acggtgatcgatgttattacggtgacctacgaagacttcaagaatcatggcaaaagcggc
aagccgttcacgccgggaaccggcacaggcgccggaacggcggagccgggcggcgcggcc
ggaagtacgaccgccccgtcgggcaccaccggaacgggcggcaacggtacgggaaccggc
ggtacgggagccgccaagccgggaacggaaacgccggcagccggaacgcaggagccggcg
gggacgtccggcaatacgacaggcacaggaggccaaaatccataa

DBGET integrated database retrieval system