KEGG   Paenibacillus mucilaginosus 3016: PM3016_563Help
Entry
PM3016_563        CDS       T01757                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00473  D-Alanine metabolism
pmq01100  Metabolic pathways
pmq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PM3016_563
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PM3016_563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmq01011]
    PM3016_563
Enzymes [BR:pmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PM3016_563
Peptidoglycan biosynthesis and degradation proteins [BR:pmq01011]
 Precursor biosynthesis
  Racemase
   PM3016_563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFC27530
UniProt: H6NSY9
LinkDB All DBs
Position
667153..668337
Genome map
AA seq 394 aa AA seqDB search
MDSFYRPTRVEISLDALRHNIGEFRRVLPEHVRMMAVVKADAYGHGAVEVCREVLQCGVE
YIAVAFLDEGLELRKAGITAPILVLGYTPPEGLETAWNHDITLNLYTDELLDAWERLGPR
ERPLRIHIKVDTGMNRIGVTGEEQAVTLIERALGIPGLQVEGLFTHYACADEEDKSYTLQ
QYARFQQVVEHFRSRGIEFPYVHAGNSAAAIDTPELTYNMVRLGISMYGLYPSDEVMKER
VDLQPVLSIKTGVVMLKKVPAGEGISYGAVYRSQEEETIATLPIGYADGFSRMLTGKAYA
LIRGRRVPIVGRICMDQCMMNVTPLADISSEEEVVILGRQGSETISAEEHAQWLGTVNYE
VVCMISHRVPRMYIRGGQVVSTINPLLRHLWERK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggattcgttttaccgtcctacgcgggtggagatctcgctggatgctttgcgccataac
atcggagagttccgcagggtgctgccggagcatgtgcggatgatggcggtggtcaaagcc
gacgcgtacggacacggtgcggtggaggtgtgccgggaggtgctgcagtgcggtgtggaa
tacatcgcggtagcattcctggacgaaggcctggagcttcggaaggcgggcattaccgct
ccgattctggtgctgggctacacgccgccggaagggctggagacagcctggaaccatgat
atcacgctcaacctgtacacggatgaacttctggatgcctgggaacgactcggaccgcgg
gagcggccgctgcgcattcacatcaaggtcgacacaggaatgaaccggatcggcgtaacc
ggtgaagagcaggccgtcacgctcatcgagcgggcgctaggcattcccggactgcaggtg
gaagggctgttcacccactatgcgtgcgcggacgaagaggacaaaagctatacgctgcag
cagtacgcgcgttttcagcaggtggtggaacacttccggagccggggaatcgagttcccc
tatgtgcacgccggcaacagtgcagcagcgattgatacgccggagctcacctacaacatg
gtgcggctcggcatctccatgtacggcctctatccgtcggatgaggtcatgaaggagcgg
gtcgacctgcagccggtcctcagtatcaagaccggtgtcgtcatgctgaagaaggtgcct
gcaggcgagggtatcagctatggcgcagtctaccggtcccaggaagaggaaacgatcgcg
acgctgcccatcgggtatgcggacggcttctcccggatgctgacgggcaaggcgtatgct
ttgatccgcggcaggcgcgtgccgatcgttgggagaatttgcatggaccagtgtatgatg
aacgttacgccccttgccgatatttctagtgaggaagaagtcgtcatattaggaaggcag
gggagcgagaccatctcggcggaagagcatgcgcagtggctgggcacagtcaattacgaa
gtcgtctgtatgatctcccaccgggtgccccggatgtacatccgcggggggcaagtggtc
tcgaccatcaatccgctgctgcggcatttatgggagcgcaaataa

DBGET integrated database retrieval system