KEGG   Paenibacillus mucilaginosus 3016: PM3016_6490Help
Entry
PM3016_6490       CDS       T01757                                 

Definition
(GenBank) YhcI
  KO
K01992  ABC-2 type transport system permease protein
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmq02000]
    PM3016_6490
Transporters [BR:pmq02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PM3016_6490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_4 ABC2_membrane_2 DUF2705 ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: AFC33116
UniProt: H6NIP9
LinkDB All DBs
Position
complement(7653182..7653964)
Genome map
AA seq 260 aa AA seqDB search
MSSLVSLVSNELMKIFARTRTWIMLGLLVVMVLAMGLIIKYVADSALMLSHALEFMGTAQ
NLTALATIFTVIVAGDIVASEFSWGTVKLLLIRPVSRGKILFSKYLAVLLFMAAMLVLLF
IVSYFTGLVLFGMSGAIGPEQSLPVLLRTYALSAVEMLMTATLAFMVSSVFRSSSLAIGL
SIFLMFTSGTAMLVLISLRYTWAKYLLFANTDLSPYFGGGPGPLVEGMTLGFSVTMLVLY
WLLFYGISWGVFTKRDVAGS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgtctagtctggtctcgctcgtaagcaacgagctgatgaagatttttgcccgcacgcgc
acctggatcatgctcggtctgctcgtggtcatggtgctggcgatggggctgatcatcaag
tacgtggcggactccgccctgatgttgagccatgcccttgagttcatgggaacggcgcag
aatctgacggccttggctacgatattcaccgtgatcgtggcgggggatatcgtcgcttcc
gaattcagctggggaacggtcaagctgctgttgatccgcccggtatcccgcggcaaaatc
ctgttctcgaagtatctggcggtcctgctcttcatggcggccatgctcgtcctgctcttc
atcgtttcgtattttaccgggctggtgctgttcgggatgagcggggcgatcggtccggag
cagagcctgccggttctcctccggacttacgcgctaagcgcggtggagatgctgatgacc
gccacgctcgcgttcatggtgtcgagcgtcttccgcagctcgtcgctggcgatcgggctg
tcgatcttcctgatgttcacttcaggaacggcgatgctggtgctgatcagcctgcgctac
acgtgggcgaagtacctgctgttcgccaatacggatctgtccccgtatttcgggggaggt
ccggggcctctggtcgaggggatgacactcggtttctccgtgacgatgctcgtgctgtac
tggctgctgttttacggcatctcgtggggagtcttcacgaaacgggacgtggccggcagc
tga

DBGET integrated database retrieval system