KEGG   Paenibacillus mucilaginosus 3016: PM3016_7022Help
Entry
PM3016_7022       CDS       T01757                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00620  Pyruvate metabolism
pmq00680  Methane metabolism
pmq01100  Metabolic pathways
pmq01120  Microbial metabolism in diverse environments
pmq01200  Carbon metabolism
Module
pmq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PM3016_7022
  09102 Energy metabolism
   00680 Methane metabolism
    PM3016_7022
Enzymes [BR:pmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PM3016_7022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AFC33609
UniProt: H6NRH4
LinkDB All DBs
Position
complement(8247236..8250025)
Genome map
AA seq 929 aa AA seqDB search
MSDSVSLIHKNTSNNLLRRDVRFLGHILGEVLVHQGGNALFTIVEKIREMSKTLRADYTP
EMYAELKETVTGLAPEIRHQVIRAFAVYFQLINIAEQNHRIRRKRDYERTAGENVQPGSI
EDSVRELKSLGISSDEVQEMIQGISLELVMTAHPTEATRRAVLDIHQRIAGDVMELDNPN
LTFREREQLREKLLGEVITLWQTDELRDRKPTVIDEVRNGLYYFDETLFDVLPEVYQELE
RCLDKYYPEEDWHVPTYLKFGSWIGGDRDGNPSVKASVTWETLTMHRKLALAKYEEELTG
LLEHMSFSRSIVEVSEELLESIEKDRREIELSSDNEWRNLKEPYRIKVKFMTERIRNTGN
PNAPAKRKYNNPDEFRADLQIIERSLRNHYADFIADTYVQKLVRQVELFGFHLAALDVRQ
HSKEHEAAMTEILAKMSICEDYSKLPEAEKIELLTAILNDPRPITSPYLRYSESTQECLD
VYRVIQKAQQEFGRSCISSYLISMTQGASDLLEVLVFGKEAGLYIHENDGSITCTLQSVP
LFETIDDLHAAPDIMTTLFKIPAYRNSLVSTNHLQEIMLGYSDSNKDGGVITANWELRVA
LRGITAAAKPFDVKLKFFHGRGGALGRGGMPLNRSILAQPADTVGGGIKITEQGEVLSSR
YSMKGIAYRSLEQATSALITSALQARNPQTNASEAEWENIMRGISEQAQTKYQDLIFRDE
DFLTFFKESTPLPEIGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAGY
GLNSFYAGKKENLQKMQEMYQNWSFFRSLIDNLQMALAKADLLIAKEYGSMIQDQSIAER
IFGLIQDEYTRTSELILNITGQQEILDNVPVIQESIRLRNPYVDPLSYMQVGLLSELRTL
RDQGEDDALLLREVLLTINGIAAGLRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattcagtcagtttaattcacaagaacacgtccaacaatttgcttcgccgggat
gtccggtttctggggcacattttgggtgaagtgctggttcaccagggcggcaatgcgctg
tttaccatcgtagagaaaatcagagagatgagtaaaacgctgcgcgccgattatacgccg
gagatgtacgccgaactgaaagaaaccgtgacgggcctggcgccggaaattcgtcaccaa
gtcatccgtgctttcgcggtgtacttccagctgatcaatattgccgagcagaaccaccgg
atccgccgcaagcgcgattacgagcggacggccggagagaacgtgcagccgggctccatc
gaggattcggtccgcgagctgaagtcgctgggcatttcgtcggacgaagtgcaggagatg
attcaaggcatctccctggagctggtcatgaccgcccacccgacggaagcaacccgccgc
gccgtgctggatattcaccagcgcatcgcaggtgacgttatggagctcgacaacccgaac
cttacgttccgggagcgggagcagctgcgcgagaaactgctgggtgaggtgattaccctc
tggcagaccgatgagctgcgcgaccgcaagccgaccgttatcgacgaagtccgcaacggt
ctgtactatttcgacgaaacgctcttcgatgtgcttcctgaagtctatcaggagctggag
cgctgtctggacaagtattatccggaagaggactggcatgtgccgacttacctgaagttc
ggctcctggatcggcggcgaccgggacggcaacccttccgtcaaggcttccgttacgtgg
gagaccctgaccatgcaccgcaagctggctctcgcgaaatacgaggaggagctgacgggg
ctgctggagcacatgagcttcagccggagcatcgttgaagtcagcgaggagcttctcgag
tcgatcgagaaggatcgccgcgagattgagctttcctcggataacgagtggcgcaacctc
aaggagccttaccgcatcaaagtgaaattcatgaccgagcgcatccgcaatacgggcaac
ccgaatgcacccgcgaagcgcaaatacaataacccggatgaattccgtgcagacctgcag
atcatcgagcgcagcctccgcaaccactatgcggacttcatcgccgatacgtatgtacag
aagctcgtccgccaagtggagctgttcggcttccatctggctgcactggatgtgcgtcag
cacagcaaggagcacgaagcggccatgacggagatcctggccaagatgagcatctgtgag
gactactcgaagcttccggaagccgagaagatcgaactgctcacagcgattctgaacgac
ccgcgtccaattacttcaccttacctgcggtacagcgaatcgacgcaggaatgcctggac
gtctaccgtgtcatccagaaagcacagcaggagttcggccgcagctgtatttcgagctac
cttatttcgatgacccagggcgcaagcgacctgctcgaagtgctcgtcttcggcaaggaa
gcggggctatacatccacgagaatgacggttccatcacatgtaccctgcagtccgtgccg
ctgttcgagacgatcgacgacctgcacgcggctccggacatcatgacgaccctcttcaaa
attccggcttaccggaattcgctcgtgtcgacgaaccacctgcaggagatcatgctcgga
tactccgacagcaacaaggacggcggcgtcatcaccgccaactgggagctgcgggtagcc
ctgcgcggcattacggcagcggctaagccgttcgacgtgaagctgaagttcttccacggc
cgcggaggggcgctgggccgcgggggcatgccgctcaaccgcagcatcctggcccagcct
gccgatacggtcggcggcggcatcaagatcacggagcagggcgaggtgctttcctcccgc
tattcgatgaagggcatcgcctaccgctccctggagcaggcgacttccgcgctcattacg
agcgcgctgcaggctagaaatccgcagacgaacgcttccgaagcggaatgggagaacatc
atgcgcggcatctccgagcaggcgcagacgaagtaccaggacctgatcttccgggacgag
gacttcctgacgttcttcaaagagtccacgccgctgccggagatcggcgaactcaacatc
ggctcccgtccttccaagcggaagaacagcgaccggtttgaggatctgcgcgcgattcca
tgggtgttcgcatggacgcagagccgttacctgctgccggcctggtacgctgccggctac
gggctgaacagcttctacgcaggcaagaaagagaaccttcagaagatgcaggagatgtac
cagaactggtcgttcttccgttccctgatcgacaatctgcagatggccctggccaaagcg
gatctgctcatcgccaaggaatacggcagcatgattcaggatcagagcatcgccgagcgg
atcttcggattgatccaggatgagtacacccgtacctcggagctcatcctgaacatcacc
ggacagcaggagattctggataacgtaccggtcatccaggaatcgatccgcctgcgcaac
ccgtatgtcgatccgctgagctacatgcaggtagggctgctctccgagcttcgcaccctg
cgggatcaaggcgaagacgatgcgctgctgctccgcgaagtgctgctgaccattaacggc
attgcagcgggcctgcggaatacgggctga

DBGET integrated database retrieval system