KEGG   Paenibacillus mucilaginosus 3016: PM3016_7068Help
Entry
PM3016_7068       CDS       T01757                                 

Definition
(GenBank) Tuf
  KO
K02358  elongation factor Tu
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pmq03012]
    PM3016_7068
   03029 Mitochondrial biogenesis [BR:pmq03029]
    PM3016_7068
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmq04147]
    PM3016_7068
Translation factors [BR:pmq03012]
 Eukaryotic Type
  Elongation factors
   PM3016_7068
 Prokaryotic Type
   PM3016_7068
Mitochondrial biogenesis [BR:pmq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PM3016_7068
Exosome [BR:pmq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PM3016_7068
  Exosomal proteins of breast cancer cells
   PM3016_7068
  Exosomal proteins of colorectal cancer cells
   PM3016_7068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFC33654
UniProt: H6NS25
LinkDB All DBs
Position
complement(8289042..8290232)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKKYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLNEYEFPGDDTPIIRGAAREALQ
NPDGPWAEKIVELFEQIDTYIPTPERDTDKPFLMPVEDVFTITGRGTVATGRVERGVIKV
GDEIEIIGLAEETRKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRKDIERGQVLAKPGS
VKPHTNFSAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIINLPEGSEMVMPGDNIT
VTVELISPIAIEEGTRFAIREGGRTVGAGAVASISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcgaaatttgaacgtaataagccgcacgttaacattggtactatcggtcac
gtcgaccacggtaaaactaccctgacggctgcaatcacaactgttctgtccaagaaatac
ggcggtgcagctgtagcattcgaccaaatcgacaaagcaccagaagagcgcgagcgtggt
atcacaatctccactgcacacgttgaatacgaaacacctaaccgtcactacgcacacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcaccggcgcagcacaaatggac
ggcgcgatcctcgtagtatccgcagctgacggccctatgccacaaactcgtgagcacatc
ctgctctcccgtcaagtaggcgtaccatacatcgttgtattcctcaacaagtgtgatatg
gttgaagacgaagagctcctcgagctcgttgaaatggaagttcgcgacctgctgaacgag
tatgagttcccaggcgacgacactccaatcatccgtggtgcagctcgtgaagcgctgcaa
aacccagatggtccttgggctgagaagatcgttgaactgttcgaacagatcgacacttac
atcccaactccagagcgcgacacggacaagcctttccttatgcctgtcgaggacgtattc
acgatcactggtcgtggtaccgttgctacaggtcgtgtagagcgtggcgttatcaaagtc
ggcgacgagatcgaaatcatcggtctggctgaagaaactcgcaagtccgttgttacaggc
gttgagatgttccgtaagcttctggactccgctcaagccggcgacaacatcggcgcactg
cttcgtggtgtagaccgtaaggacatcgagcgtggtcaagttctggcgaagccgggttcg
gttaagcctcacacgaacttttccgcacaaatctacgtcctgactaaagaagaaggtggc
cgtcacaagcctttcttcactggctaccgtccacagttctacttccgcacaacggacgta
acaggcatcatcaacctgcctgaaggttccgagatggttatgccaggcgacaacatcact
gtaacggttgagctgatctccccgatcgctatcgaggaaggcactcgcttcgctatccgc
gaaggcggccgtacagttggtgcaggcgcggttgcttccatcagcaagtaa

DBGET integrated database retrieval system