KEGG   Paenibacillus mucilaginosus 3016: PM3016_913Help
Entry
PM3016_913        CDS       T01757                                 

Definition
(GenBank) GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00970  Aminoacyl-tRNA biosynthesis
pmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PM3016_913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pmq03029]
    PM3016_913
Enzymes [BR:pmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PM3016_913
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PM3016_913
Mitochondrial biogenesis [BR:pmq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PM3016_913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFC27857
UniProt: H6N9B1
LinkDB All DBs
Position
1061431..1062882
Genome map
AA seq 483 aa AA seqDB search
MTAATDKKYETVIGLEVHVELHTQSKIFCGCSTAFGAPANTHTCPVCLGHPGVLPVLNKQ
AVEYAMKAAMALNCQVATESKFDRKNYFYPDSPKAYQISQYDKPVGEHGWIDIEVNGETK
RIGITRVHLEEDAGKLTHVDGGYASLVDFNRVGTPLIEIVSEPDLRSPEEARAYLEKIRA
IMQYCDVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNMNSFRGVQRGLEYEEWRQA
DVLENGGEVVQETRRWDEAQGKTLSMRGKEQAHDYRYFPDPDLVALHISDEWKDRVRASI
PELPDARKKRYVGEYNLPSYDAEVITSQMKLADFFEESLKYTQDAKAMSNWIMGELLGYL
NANGLELEDVKITGKGLGEMIGLIEKGTISSKIAKTVFKAMLESGKDPQVIVEEQGLVQI
SDEGAIAAIVDTIIANNPQSVADYKAGKEKAVGFLVGQAMKETKGKANPGMLNKLILEKL
NGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcagcaaccgacaagaagtatgaaacggtcatcggactcgaggtgcacgtcgaa
ctgcatacgcagtccaaaattttctgcggctgctccaccgcattcggggccccggcgaac
acgcatacgtgtcccgtctgtctcggtcacccgggcgtgcttcccgtcctgaacaaacag
gcggtggagtatgcgatgaaggcggccatggcgctgaactgccaggtggcaacggagagc
aagtttgaccgcaaaaactatttttacccggattccccgaaggcttatcagatctcgcag
tacgacaagccggtcggcgagcacggctggatcgacatcgaagtgaacggcgagacgaag
cgcatcggcatcacccgcgtccatctcgaggaagacgccggcaagctgacgcacgtggac
ggcggctatgcgtccctcgtggacttcaaccgcgtcggcaccccgctcatcgagatcgtc
tcggagccggatctgcgttcgccggaggaagcccgcgcgtatctcgagaagatccgtgcg
atcatgcagtactgcgacgtgtcggacgtgaagatggaagagggctcgctgcgctgcgac
gcgaacatttccctgcgtccttacgggcaggagaagttcggcacgaaggccgagctcaag
aacatgaactcgttccgcggcgtacagcgcggtctggagtatgaagagtggcgccaggcg
gatgtgctggagaacggcggcgaagtggtgcaggagacgcgccgctgggatgaagcccag
ggcaagacgctcagcatgcgcggcaaggagcaggcgcatgactaccgctatttcccggat
ccggatcttgtggcgctgcatatcagcgacgagtggaaggaccgcgtgcgcgcctcgatt
ccggagctgccggatgcccgcaagaagcgctatgtcggcgagtacaatctgccgagctac
gatgcggaggtcattacctcgcagatgaagctggcggacttcttcgaggagagtctgaag
tatacgcaggacgccaaggccatgtcgaactggattatgggcgaactgctcggctatctg
aatgcgaacgggctggagctcgaagacgtgaagatcacgggcaagggcctcggtgagatg
atcggcctgatcgagaagggcacgatctcgagcaagatcgcgaagacggtgttcaaagcg
atgctggagtcgggcaaggatcctcaggtgatcgtcgaagagcaggggctcgtgcagatc
agcgacgaaggcgccatcgcggctatcgtcgatacgatcattgcgaacaacccgcagtcg
gttgccgactataaggcgggcaaggagaaggccgttggcttcctggtcggacaagcgatg
aaggaaaccaaaggcaaggccaacccgggtatgctcaataagctgattctggagaagctg
aacggagcataa

DBGET integrated database retrieval system